(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_1

ID   ACAM1_1; SV 1; empty ; DNA; empty ; PRO; 6503724 BP.
XX
AC   NC_009925;
XX
PR   Project: 58167;
XX
DE   Acaryochloris marina MBIC11017, complete genome.
XX
OS   Acaryochloris marina MBIC11017
OC   Bacteria; Cyanobacteria; Acaryochloris.
XX
RN   [1]
RP   1-6503724
RX   PUBMED; 18252824.
RA   Swingley,W.D., Chen,M., Cheung,P.C., Conrad,A.L., Dejesa,L.C., Hao,J.,
RA   Honchak,B.M., Karbach,L.E., Kurdoglu,A., Lahiri,S., Mastrian,S.D.,
RA   Miyashita,H., Page,L., Ramakrishna,P., Satoh,S., Sattley,W.M., Shimada,Y.,
RA   Taylor,H.L., Tomo,T., Tsuchiya,T., Wang,Z.T., Raymond,J., Mimuro,M.,
RA   Blankenship,R.E. and Touchman,J.W.;
RT   "Niche adaptation and genome expansion in the chlorophyll d-producing
RT   cyanobacterium Acaryochloris marina";
RL   Proc. Natl. Acad. Sci. U.S.A. 105 (6), 2005-2010 (2008)
XX
RN   [2]
RP   1-6503724
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (17-OCT-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-6503724
RA   Touchman,J.W.;
RT   "Direct Submission";
RL   Submitted (27-AUG-2007) Pharmaceutical Genomics Division, Translational
RL   Genomics Research Institute, 13208 E Shea Blvd, Scottsdale, AZ 85004, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000828.
CC   Source bacteria from Marine Biotechnology Institute Culture
CC   Collection, Marine Biotechnology Institute, 3-75-1 Heita, Kamaishi,
CC   Iwate 026-0001, Japan.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..6503724
FT                   /note="type strain of Acaryochloris marina"
FT                   /strain="MBIC11017"
FT                   /mol_type="genomic DNA"
FT                   /organism="Acaryochloris marina MBIC11017"
FT                   /db_xref="taxon:329726"
FT   gene            complement(931..1581)
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GeneID:5685235"
FT                   /locus_tag="AM1_0001"
FT                   /pseudo
FT   gene            complement(1627..2319)
FT                   /db_xref="GeneID:5678840"
FT                   /locus_tag="AM1_0003"
FT   CDS_pept        complement(1627..2319)
FT                   /locus_tag="AM1_0003"
FT                   /gene_family="HOG000261973" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NUDIX hydrolase"
FT                   /transl_table="11"
FT                   /db_xref="GI:158333234"
FT                   /db_xref="GeneID:5678840"
FT                   /translation="MPYTYDYPRPGLTVDCVVFGLDEQIDLKVLLIQRQIPPFQHQWAL
FT                   PGGFVQMDESLEDAARRELREETGVQGIFLEQLYTFGDLGRDPRDRIISVAYYALINLI
FT                   EYPLQASTDAEDAAWYSIENLPSLAFDHAQILKQAIRRLQGKVRYEPIGFELLPQKFTL
FT                   TQIQQLYETVLGHPLDKRNFRKKLLKMDLLIPLDEQQTGVAHRAARLYQFDQSKYELLK
FT                   QQGFNFEV"
FT                   /protein_id="YP_001514406.1"
FT   misc_feature    complement(1945..2286)
FT                   /note="Nudix hydrolase is a superfamily of enzymes found in
FT                   all three kingdoms of life, and it catalyzes the hydrolysis
FT                   of NUcleoside DIphosphates linked to other moieties, X.
FT                   Enzymes belonging to this superfamily require a divalent
FT                   cation, such as Mg2+ or...; Region: Nudix_Hydrolase;
FT                   cl00447"
FT                   /db_xref="CDD:176581"
FT                   /locus_tag="AM1_0003"
FT   misc_feature    complement(order(2116..2142,2170..2178))
FT                   /note="nudix motif; other site"
FT                   /db_xref="CDD:72880"
FT                   /locus_tag="AM1_0003"
FT   misc_feature    complement(1675..>1995)
FT                   /note="Nudix hydrolase is a superfamily of enzymes found in
FT                   all three kingdoms of life, and it catalyzes the hydrolysis
FT                   of NUcleoside DIphosphates linked to other moieties, X.
FT                   Enzymes belonging to this superfamily require a divalent
FT                   cation, such as Mg2+ or...; Region: Nudix_Hydrolase;
FT                   cl00447"
FT                   /db_xref="CDD:176581"
FT                   /locus_tag="AM1_0003"
FT   gene            2404..3255
FT                   /db_xref="GeneID:5678841"
FT                   /locus_tag="AM1_0004"
FT   CDS_pept        2404..3255
FT                   /locus_tag="AM1_0004"
FT                   /gene_family="HOG000025501" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158333235"
FT                   /db_xref="GeneID:5678841"
FT                   /translation="MQQHFEVAAGSILGQNHRRVSQNNQDAWASLTLGQATIAVVCDGC
FT                   GSRPKSEVGAQLGAQLTVHALAQLVAEEQPEDELFWQMLRKHLLGGMQTLQERLGADSQ
FT                   RLVDYWLFTLMGCLVTPETTWIFGLGDGVFAINEEFHQIGPFTNNAPPYLAYSLLWNTE
FT                   KGLDPFQLQIYAQHPTEQVQSVLIGSDGVGDLVNVAEDYLPGKSELVGPLNQFWCCDRY
FT                   FQNPDQVRRRLAQINREVIQPDWHTRQVRKIPGLLPDDTTLISIRRKGTKEGGSDARCN
FT                   CR"
FT                   /protein_id="YP_001514407.1"
FT   misc_feature    2446..>2832
FT                   /note="Serine/threonine phosphatases, family 2C, catalytic
FT                   domain; The protein architecture and deduced catalytic
FT                   mechanism of PP2C phosphatases are similar to the PP1,
FT                   PP2A, PP2B family of protein Ser/Thr phosphatases, with
FT                   which PP2C shares no sequence...; Region: PP2Cc; cl00120"
FT                   /db_xref="CDD:153523"
FT                   /locus_tag="AM1_0004"
FT   gene            3233..4009
FT                   /db_xref="GeneID:5678842"
FT                   /locus_tag="AM1_0005"
FT   CDS_pept        3233..4009
FT                   /locus_tag="AM1_0005"
FT                   /gene_family="HOG000131992" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ADP-ribosylglycohydrolase"
FT                   /transl_table="11"
FT                   /db_xref="GI:158333236"
FT                   /db_xref="GeneID:5678842"
FT                   /translation="MLGAIAGDIIGSVFEPHWRRIKRKEFDLFSKKSKFTDDTVLTIAV
FT                   ADAILHQKAYAHTIKDYYRRYPKAGYGKTFREWGASDSMEAYHSWGNGSAMRVSAVGFA
FT                   FDDLETVLQEAEQSAAVTHNRPEGIKGAQATAAAIYLGRQGRSKAEIKTYIETTFGYDL
FT                   RLSLEEIRPQYQFDSSCQGSVPQAITAFLESTDFEDAIRNAVSLGGDSDTQACIAGGIA
FT                   QGFYGGVPKQIAQETWARLDADLQQVVEAFMATYQI"
FT                   /protein_id="YP_001514408.1"
FT   misc_feature    3233..4000
FT                   /note="ADP-ribosylglycohydrolase; Region: ADP_ribosyl_GH;
FT                   cl00614"
FT                   /db_xref="CDD:153890"
FT                   /locus_tag="AM1_0005"
FT   gene            4171..6042
FT                   /db_xref="GeneID:5678843"
FT                   /locus_tag="AM1_0006"
FT   CDS_pept        4171..6042
FT                   /locus_tag="AM1_0006"
FT                   /gene_family="HOG000025500" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158333237"
FT                   /db_xref="GeneID:5678843"
FT                   /translation="MDVYINQKRVRLRPQQAIGKGGEADVYRLNRTTAVKLFKPPSHPD
FT                   FEGMVEAQQGARERLALHQQKLRQFPQSLPERVISPQALVMNQNGQRILGYTMPLLTHA
FT                   EVLLRYCDRRRRVKDHCRRQVGDHRKFQQAVDTQAVVDLFLDLHETVSKLHFADVVIGD
FT                   FNDLNILVQGTQAFVIDADSFQFGSFPCSVFTARFVDPLLCDPQGTQPILCRPYCWESD
FT                   WYAFTVMLMQALLFVDPYGGVYKPSDPAQRLPQAARPLHRVTVFHPQVRYPKPALPCDH
FT                   LPKPLLDHFRQVFEQDWRGEFPRSLLENLRWHTCPSCGVEHARSACPSCVKSVGIPMPP
FT                   GAVQVTTVLQTNGVILAATLTAGQLQWLVWEEGQFKREDGTVVLTGDLSPEFDWHLQGQ
FT                   TTWIVQQGQVVELPTTERIAVDSYQGRPQFAVNDRHSYWFNQGQLMRDHAVMGEVLIGQ
FT                   TQFWVGPRFGLGFYRAGQLNGAFVFDADRSGINDRLSLSMEAGTVVAAHCTFSQSFGWL
FT                   FVTLQAQGVLQQRCWVIAPTGQVLAQAEVGEWAATASGPCPHWAVEEALFVATDEGIIR
FT                   AQVEQGQVIVQRRFPETEPFVQTGCQLLAAPQGLYTVGSQTIQLLQL"
FT                   /protein_id="YP_001514409.1"
FT   misc_feature    4210..>5055
FT                   /note="Uncharacterized protein with protein kinase and
FT                   helix-hairpin-helix DNA-binding domains [General function
FT                   prediction only]; Region: COG4248"
FT                   /db_xref="CDD:33971"
FT                   /locus_tag="AM1_0006"
FT   gene            6057..7085
FT                   /db_xref="GeneID:5678844"
FT                   /locus_tag="AM1_0007"
FT   CDS_pept        6057..7085
FT                   /locus_tag="AM1_0007"
FT                   /gene_family="HOG000225017" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158333238"
FT                   /db_xref="GeneID:5678844"
FT                   /translation="MLTQLPIPDFFDPQRVGEVWRVPYQERAQQAQDWANQQGIQPAAK
FT                   DKTRVCLMAIDVQNTFCIPEFELFVGGPSGMGAVEDNRRLCEFIYRNLGTITEIAPTMD
FT                   THTAMQIFHADFWVNDRGESPAPLTMIPLAEVEQGAWKVNPAMAYSLGNYMALQNFARH
FT                   YVQSLSQEGKYPLTIWPYHSMLGGIGHALVAAVEEACFFHNLARHSQTHFEIKGGNPLT
FT                   ENYSVLRPEVLDDPKGRPIAQKNTRFIQKLLDFDAVIIAGQAKSHCVAWTIDDLLTEIQ
FT                   AHDPSLAQKIYLLEDCSSPVVVPGVVDFTEQANEAFLRFQQAGMHVVQSTEAISTWPGI
FT                   HL"
FT                   /protein_id="YP_001514410.1"
FT   misc_feature    6201..7040
FT                   /note="Cysteine hydrolases; This family contains
FT                   amidohydrolases, like CSHase (N-carbamoylsarcosine
FT                   amidohydrolase), involved in creatine metabolism and
FT                   nicotinamidase, converting nicotinamide to nicotinic acid
FT                   and ammonia in the pyridine nucleotide cycle. It...;
FT                   Region: cysteine_hydrolases; cl00220"
FT                   /db_xref="CDD:174043"
FT                   /locus_tag="AM1_0007"
FT   misc_feature    order(6222..6224,6702..6704,6858..6860)
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:29548"
FT                   /locus_tag="AM1_0007"
FT   misc_feature    6843..6848
FT                   /note="conserved cis-peptide bond; other site"
FT                   /db_xref="CDD:29548"
FT                   /locus_tag="AM1_0007"
FT   gene            7272..8051
FT                   /db_xref="GeneID:5678845"
FT                   /locus_tag="AM1_0008"
FT   CDS_pept        7272..8051
FT                   /locus_tag="AM1_0008"
FT                   /gene_family="HOG000025499" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158333239"
FT                   /db_xref="GeneID:5678845"
FT                   /translation="MSQVPNLNTLFQSAQADGVLSNASMQALNVVDIGAQIQAGLGTPV
FT                   DDVMASEVVLVTIMPDDSGSIRFAGNGAVVRAGHNMVLDTLAMSPQQDQILVHNRYLNG
FT                   AVLYPYCPVDQALRMDQHNYDPNLGTPLYDQTLVLLATVLAKAQAFIDNGVPARTVSLI
FT                   ITDGADAHSRRSVREVKGVVEDMLRTEDHIIAAMGINDGQTDFKRVFREMGVRDQWILT
FT                   PGNSQNEIRKAFQLFSQSVLRASQSAHNFNSWGGFGP"
FT                   /protein_id="YP_001514411.1"
FT   gene            complement(8126..8617)
FT                   /db_xref="GeneID:5678846"
FT                   /locus_tag="AM1_0009"
FT   CDS_pept        complement(8126..8617)
FT                   /locus_tag="AM1_0009"
FT                   /gene_family="HOG000187907" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CBS domain-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158333240"
FT                   /db_xref="GeneID:5678846"
FT                   /translation="MAESHPVVKDFMTPDPITISPTDSIERVIKLIEDHRISGMPVVDA
FT                   SNHVVGIISEGDLLVRESPMQPPLYMTLLGSVIYFESPKQFHQHMQKALGMLVQDVMTS
FT                   QPITTKPDIPLTSAANLMLSKKINRLPVVDNDQYLIGIITRHDLVRALKPAVTYESLPD
FT                   "
FT                   /protein_id="YP_001514412.1"
FT   misc_feature    complement(8171..8596)
FT                   /note="FOG: CBS domain [General function prediction only];
FT                   Region: COG0517"
FT                   /db_xref="CDD:30863"
FT                   /locus_tag="AM1_0009"
FT   misc_feature    complement(8165..8578)
FT                   /note="The CBS domain, named after human CBS, is a small
FT                   domain originally identified in cystathionine beta-synthase
FT                   and is subsequently found in a wide range of different
FT                   proteins. CBS domains usually occur in tandem repeats. They
FT                   associate to form a so-...; Region: CBS_pair_23; cd04636"
FT                   /db_xref="CDD:73134"
FT                   /locus_tag="AM1_0009"
FT   gene            complement(8664..9083)
FT                   /db_xref="GeneID:5678847"
FT                   /locus_tag="AM1_0010"