(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_2

ID   ACAM1_2; SV 1; empty ; DNA; empty ; PRO; 374161 BP.
XX
AC   NC_009926;
XX
PR   Project: 58167;
XX
DE   Acaryochloris marina MBIC11017 plasmid pREB1, complete sequence.
XX
OS   Acaryochloris marina MBIC11017
OC   Bacteria; Cyanobacteria; Acaryochloris.
XX
RN   [1]
RP   1-374161
RX   PUBMED; 18252824.
RA   Swingley,W.D., Chen,M., Cheung,P.C., Conrad,A.L., Dejesa,L.C., Hao,J.,
RA   Honchak,B.M., Karbach,L.E., Kurdoglu,A., Lahiri,S., Mastrian,S.D.,
RA   Miyashita,H., Page,L., Ramakrishna,P., Satoh,S., Sattley,W.M., Shimada,Y.,
RA   Taylor,H.L., Tomo,T., Tsuchiya,T., Wang,Z.T., Raymond,J., Mimuro,M.,
RA   Blankenship,R.E. and Touchman,J.W.;
RT   "Niche adaptation and genome expansion in the chlorophyll d-producing
RT   cyanobacterium Acaryochloris marina";
RL   Proc. Natl. Acad. Sci. U.S.A. 105 (6), 2005-2010 (2008)
XX
RN   [2]
RP   1-374161
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (17-OCT-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-374161
RA   Touchman,J.;
RT   "Direct Submission";
RL   Submitted (25-SEP-2007) Translational Genomics Research Institute, 13208 E
RL   Shea Blvd, Scottsdale, AZ 85004, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000838.
CC   Source bacteria from Marine Biotechnology Institute Culture
CC   Collection, Marine Biotechnology Institute, 3-75-1 Heita, Kamaishi,
CC   Iwate 026-0001, Japan.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..374161
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:329726"
FT                   /note="type strain of Acaryochloris marina"
FT                   /strain="MBIC11017"
FT                   /plasmid="pREB1"
FT                   /organism="Acaryochloris marina MBIC11017"
FT   gene            join(373616..374161,1..174)
FT                   /db_xref="GeneID:5685236"
FT                   /locus_tag="AM1_A0001"
FT   CDS_pept        join(373616..374161,1..174)
FT                   /locus_tag="AM1_A0001"
FT                   /gene_family="HOG000136926" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glutathione S-transferase, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339653"
FT                   /db_xref="GeneID:5685236"
FT                   /translation="MKIVSFKICPFVQRVTALLEAKGIDYDIEYIDLSHKPQWFLDLSP
FT                   NAQVPILITDDDDVLFESDAIVEFLDEVVGTPLSSDNAVKKAQDRAWSYLATKHYLVQC
FT                   SAQRSPDAKTLEERSKKLSKAFGKIKVQLGESRYINGDDLSMVDIAWLPLLHRAAIIEQ
FT                   YSGYDFLEEFPKVKQWQQHLLSTGIAEKSVPEDFEERFTAFYLAESTCLGQLAKSKNGE
FT                   ACCGTAECTVDDLGCCA"
FT                   /protein_id="YP_001520660.1"
FT   misc_feature    join(373616..374161,1..63)
FT                   /note="Glutathione S-transferase [Posttranslational
FT                   modification, protein turnover, chaperones]; Region: Gst;
FT                   COG0625"
FT                   /db_xref="CDD:30970"
FT   misc_feature    <373616..373828
FT                   /note="Protein Disulfide Oxidoreductases and Other Proteins
FT                   with a Thioredoxin fold; Region: Thioredoxin_like; cl00388"
FT                   /db_xref="CDD:176818"
FT                   /locus_tag="AM1_A0001"
FT   misc_feature    join(373895..374161,1..3)
FT                   /note="Glutathione S-transferase (GST) family, C-terminal
FT                   alpha helical domain; a large, diverse group of cytosolic
FT                   dimeric proteins involved in cellular detoxification by
FT                   catalyzing the conjugation of  glutathione (GSH) with a
FT                   wide range of endogenous and...; Region: GST_C_family;
FT                   cd00299"
FT                   /db_xref="CDD:48103"
FT                   /locus_tag="AM1_A0001"
FT   misc_feature    order(373895..373900,373907..373912,374075..374077,
FT                   374084..374086)
FT                   /note="substrate binding pocket (H-site); other site"
FT                   /db_xref="CDD:48103"
FT                   /locus_tag="AM1_A0001"
FT   misc_feature    order(374051..374053,374060..374065,374072..374074,
FT                   374084..374086)
FT                   /note="N-terminal domain interface; other site"
FT                   /db_xref="CDD:48103"
FT                   /locus_tag="AM1_A0001"
FT   gene            241..381
FT                   /db_xref="GeneID:5685411"
FT                   /locus_tag="AM1_A0002"
FT   CDS_pept        241..381
FT                   /locus_tag="AM1_A0002"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339654"
FT                   /db_xref="GeneID:5685411"
FT                   /translation="MLINPEDKQVEIYRPGQDVELLQSPSTISGADVLPEFSLNLEWIW
FT                   R"
FT                   /protein_id="YP_001520661.1"
FT   gene            388..525
FT                   /db_xref="GeneID:5685412"
FT                   /locus_tag="AM1_A0003"
FT   CDS_pept        388..525
FT                   /locus_tag="AM1_A0003"
FT                   /gene_family="HOG000022973" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339655"
FT                   /db_xref="GeneID:5685412"
FT                   /translation="MKEAGFSENSRSREGQPKLAKDAAIAKPYLVAMTAELQIMATETL
FT                   "
FT                   /protein_id="YP_001520662.1"
FT   gene            complement(533..1318)
FT                   /db_xref="GeneID:5685413"
FT                   /locus_tag="AM1_A0004"
FT   CDS_pept        complement(533..1318)
FT                   /locus_tag="AM1_A0004"
FT                   /gene_family="HOG000022974" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339656"
FT                   /db_xref="GeneID:5685413"
FT                   /translation="MKTLRWLIDLHPEFPASEIVAGYLRQHKKIEPIVIDRDDVMLGRW
FT                   PDTEDWIVGYGTMFAMTRLLRHPPLSTAIFDDYSSLRCSKYYSYIYPFLGRAFLFAPFG
FT                   ALPNLPLQRMFGDNIFVRSDTNYKLFPAEVLKTQELSHWVKTFSHHQNELAVVSEVVSF
FT                   EAEYRCFCRNGIFFCGSSYPDEPYSEVPQEIRSVAESVAQALDVTGMNMLTVDIGIHAG
FT                   EPKLVEIGGVNSWGIYGSNVADFIAAMEEEAVDRWEDLI"
FT                   /protein_id="YP_001520663.1"
FT   gene            complement(1515..2012)
FT                   /db_xref="GeneID:5685414"
FT                   /locus_tag="AM1_A0005"
FT   CDS_pept        complement(1515..2012)
FT                   /locus_tag="AM1_A0005"
FT                   /gene_family="HOG000291291" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="rod shape-determining protein MreB, putative"
FT                   /transl_table="11"
FT                   /note="Member of COG1077, Actin-like ATPases involved in
FT                   cell morphogenesis."
FT                   /db_xref="GI:158339657"
FT                   /db_xref="GeneID:5685414"
FT                   /translation="MNLVQRLMGIFSEDLLIELTKSEVSITSFSSGATVKDKPLIAVSG
FT                   EKNKLTVEGVGAECQNMSKPGLQLINPFDHSRSFVANFTYAEKILQYLIRKLLRNRLIT
FT                   SPRVIIHQLEKNEGGLTEIEERVLRELALGAGAREVIVFQGSKINTNVDTYQTIKQRVD
FT                   AT"
FT                   /protein_id="YP_001520664.1"
FT   misc_feature    complement(<1599..1874)
FT                   /note="hypothetical protein; Provisional; Region: PRK10039"
FT                   /db_xref="CDD:170217"
FT                   /locus_tag="AM1_A0005"
FT   gene            complement(2745..3191)
FT                   /db_xref="GeneID:5685415"
FT                   /locus_tag="AM1_A0006"
FT   CDS_pept        complement(2745..3191)
FT                   /locus_tag="AM1_A0006"
FT                   /gene_family="HOG000022977" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339658"
FT                   /db_xref="GeneID:5685415"
FT                   /translation="MTQVLTAQFLFPAKEFDTQYGPRLNAKIKVANGEEAKLWGPPGDV
FT                   ALLALRRGQTIQIAKDGKGKYSLVEQASAPGQAPVVGDAPLDDGALDGDTKSVIASYIS
FT                   NRAALYSFCYQEASRELGKHDASEETIKCAASTLFIAAQKKFGI"
FT                   /protein_id="YP_001520665.1"
FT   gene            complement(3340..3681)
FT                   /db_xref="GeneID:5685416"
FT                   /locus_tag="AM1_A0007"
FT   CDS_pept        complement(3340..3681)
FT                   /locus_tag="AM1_A0007"
FT                   /gene_family="HOG000022978" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339659"
FT                   /db_xref="GeneID:5685416"
FT                   /translation="MDVQILEVLSIQLKVGDVLELTLVDEEFAPEQMIEIPIACKLVKS
FT                   DAILLHFHPHELELDLNTVDIHSKKDQRYLTVRSLEIVDTEKGYLATEDESGTARYQVM
FT                   WKKIANTYD"
FT                   /protein_id="YP_001520666.1"
FT   gene            complement(3724..3879)
FT                   /db_xref="GeneID:5685417"
FT                   /locus_tag="AM1_A0008"
FT   CDS_pept        complement(3724..3879)
FT                   /locus_tag="AM1_A0008"
FT                   /gene_family="HOG000022979" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339660"
FT                   /db_xref="GeneID:5685417"
FT                   /translation="MNIYVAQIEVWNGRTFQVIDFQMADNGESLGTVIREYVAAIGLRL
FT                   VYWCKL"
FT                   /protein_id="YP_001520667.1"
FT   gene            complement(4078..4707)
FT                   /db_xref="GeneID:5685418"
FT                   /locus_tag="AM1_A0009"