(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_2.PE3

ACAM1_2.PE3          Location/Qualifiers
FT   CDS_pept        388..525
FT                   /locus_tag="AM1_A0003"
FT                   /gene_family="HOG000022973" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339655"
FT                   /db_xref="GeneID:5685412"
FT                   /translation="MKEAGFSENSRSREGQPKLAKDAAIAKPYLVAMTAELQIMATETL
FT                   "
FT                   /protein_id="YP_001520662.1"
     TTGAAGGAGG CAGGATTTTC GGAAAATTCG CGATCGCGTG AAGGCCAACC CAAACTGGCG        60
     AAAGATGCTG CGATCGCGAA GCCGTACCTT GTCGCAATGA CAGCAGAACT CCAAATAATG       120
     GCTACGGAGA CTTTGTAG                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page