(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_2.PE4

ACAM1_2.PE4          Location/Qualifiers
FT   CDS_pept        complement(533..1318)
FT                   /locus_tag="AM1_A0004"
FT                   /gene_family="HOG000022974" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339656"
FT                   /db_xref="GeneID:5685413"
FT                   /translation="MKTLRWLIDLHPEFPASEIVAGYLRQHKKIEPIVIDRDDVMLGRW
FT                   PDTEDWIVGYGTMFAMTRLLRHPPLSTAIFDDYSSLRCSKYYSYIYPFLGRAFLFAPFG
FT                   ALPNLPLQRMFGDNIFVRSDTNYKLFPAEVLKTQELSHWVKTFSHHQNELAVVSEVVSF
FT                   EAEYRCFCRNGIFFCGSSYPDEPYSEVPQEIRSVAESVAQALDVTGMNMLTVDIGIHAG
FT                   EPKLVEIGGVNSWGIYGSNVADFIAAMEEEAVDRWEDLI"
FT                   /protein_id="YP_001520663.1"
     atgaagactt tgcgctggct gatagacttg cacccagagt tcccagcatc ggagatagtt        60
     gcaggatatt taagacaaca taagaaaata gagcccatcg tcatcgatcg ggacgatgta       120
     atgttaggta gatggccaga tactgaagat tggattgtgg gctacgggac gatgtttgct       180
     atgacccgct tgctcaggca tccaccactc agtacagcta tttttgacga ttattcgagt       240
     ctaaggtgct ctaaatacta ttcttacatc tatccttttt taggacgtgc tttcctattt       300
     gcaccatttg gagcactacc caatttaccc cttcaaagga tgttcggaga taatattttt       360
     gtccgttccg ataccaatta caagcttttc ccagcggagg tcttaaaaac ccaagagctt       420
     tcacattggg taaagacttt ctcacatcat caaaatgagc tagctgtggt ctctgaagtg       480
     gtttcatttg aggctgaata ccgttgcttt tgccggaacg gaatattttt ctgcggcagc       540
     tcgtatccag acgagccata ctctgaagtg cctcaggaga taagatccgt tgcagagagt       600
     gttgcacaag ccttggacgt aactggtatg aacatgctga ctgttgacat tgggatacat       660
     gctggcgaac ctaagcttgt ggaaattggc ggggtcaaca gctgggggat ttatggatcg       720
     aacgtggctg attttattgc tgccatggag gaagaagccg tagaccgttg ggaagacttg       780
     atctga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page