(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_2.PE5

ACAM1_2.PE5          Location/Qualifiers
FT   CDS_pept        complement(1515..2012)
FT                   /locus_tag="AM1_A0005"
FT                   /gene_family="HOG000291291" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="rod shape-determining protein MreB, putative"
FT                   /transl_table="11"
FT                   /note="Member of COG1077, Actin-like ATPases involved in
FT                   cell morphogenesis."
FT                   /db_xref="GI:158339657"
FT                   /db_xref="GeneID:5685414"
FT                   /translation="MNLVQRLMGIFSEDLLIELTKSEVSITSFSSGATVKDKPLIAVSG
FT                   EKNKLTVEGVGAECQNMSKPGLQLINPFDHSRSFVANFTYAEKILQYLIRKLLRNRLIT
FT                   SPRVIIHQLEKNEGGLTEIEERVLRELALGAGAREVIVFQGSKINTNVDTYQTIKQRVD
FT                   AT"
FT                   /protein_id="YP_001520664.1"
     gtgaacttgg ttcaaagact aatgggcatt ttttcagaag atctcctcat tgaacttacc        60
     aaatctgaag taagcatcac ctcgttttca agtggggcca ctgtaaaaga caaaccatta       120
     atcgccgtaa gcggagaaaa aaataaattg acggttgagg gtgttggcgc tgaatgtcaa       180
     aacatgagta agcctgggct gcaactcata aatccctttg atcattcccg ctctttcgtc       240
     gcaaacttca catatgctga aaaaatactg caatatttga tccggaaact tctgagaaat       300
     cggctcataa cttctcctag agtaataatt catcaactgg agaagaatga aggtgggctt       360
     acggaaattg aggagagagt gttaagagag ctagcattgg gtgctggcgc cagagaggtt       420
     attgtttttc aagggtcgaa gattaacacc aatgtggaca cataccagac cattaagcaa       480
     agagttgacg ccacctaa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page