(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_2.PE6

ACAM1_2.PE6          Location/Qualifiers
FT   CDS_pept        complement(2745..3191)
FT                   /locus_tag="AM1_A0006"
FT                   /gene_family="HOG000022977" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339658"
FT                   /db_xref="GeneID:5685415"
FT                   /translation="MTQVLTAQFLFPAKEFDTQYGPRLNAKIKVANGEEAKLWGPPGDV
FT                   ALLALRRGQTIQIAKDGKGKYSLVEQASAPGQAPVVGDAPLDDGALDGDTKSVIASYIS
FT                   NRAALYSFCYQEASRELGKHDASEETIKCAASTLFIAAQKKFGI"
FT                   /protein_id="YP_001520665.1"
     atgacccagg tactcactgc ccaattccta ttcccggcta aagaatttga tactcagtat        60
     ggcccacgcc tcaacgccaa aatcaaggta gcgaatggtg aagaggctaa gttatgggga       120
     ccacctggcg atgtagcttt gctcgctctc cgtagaggcc aaaccatcca gattgccaaa       180
     gatggcaaag gcaagtacag cctggtcgag caagcctcgg caccaggtca ggccccagtg       240
     gttggggatg cgcccctgga tgatggggcg ttggatgggg ataccaagag tgtgattgct       300
     agctatattt ctaaccgagc ggccctctat tcattttgtt atcaagaggc gtccagggag       360
     ctagggaagc acgatgcaag tgaggagacc atcaagtgtg ctgccagcac cttgttcatt       420
     gctgctcaga agaagtttgg aatttga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page