(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_2.PE7

ACAM1_2.PE7          Location/Qualifiers
FT   CDS_pept        complement(3340..3681)
FT                   /locus_tag="AM1_A0007"
FT                   /gene_family="HOG000022978" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339659"
FT                   /db_xref="GeneID:5685416"
FT                   /translation="MDVQILEVLSIQLKVGDVLELTLVDEEFAPEQMIEIPIACKLVKS
FT                   DAILLHFHPHELELDLNTVDIHSKKDQRYLTVRSLEIVDTEKGYLATEDESGTARYQVM
FT                   WKKIANTYD"
FT                   /protein_id="YP_001520666.1"
     atggatgttc aaatcttaga agtactctcc atccagctca aggttggtga tgtcctagaa        60
     ctaactttgg ttgatgagga atttgcccca gagcaaatga ttgaaatccc gattgcttgc       120
     aagctggtca aatcggatgc aattcttctt cacttccacc ctcatgaatt ggagttggac       180
     ttgaacacgg tagacataca ctccaaaaaa gaccaacgat atctgaccgt tcgtagcttg       240
     gagattgttg atactgagaa aggatatcta gctactgaag acgagagtgg aactgctcgc       300
     tatcaagtga tgtggaagaa aatagcgaac acctatgatt ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page