(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_3

ID   ACAM1_3; SV 1; empty ; DNA; empty ; PRO; 356087 BP.
XX
AC   NC_009927;
XX
PR   Project: 58167;
XX
DE   Acaryochloris marina MBIC11017 plasmid pREB2, complete sequence.
XX
OS   Acaryochloris marina MBIC11017
OC   Bacteria; Cyanobacteria; Acaryochloris.
XX
RN   [1]
RP   1-356087
RX   PUBMED; 18252824.
RA   Swingley,W.D., Chen,M., Cheung,P.C., Conrad,A.L., Dejesa,L.C., Hao,J.,
RA   Honchak,B.M., Karbach,L.E., Kurdoglu,A., Lahiri,S., Mastrian,S.D.,
RA   Miyashita,H., Page,L., Ramakrishna,P., Satoh,S., Sattley,W.M., Shimada,Y.,
RA   Taylor,H.L., Tomo,T., Tsuchiya,T., Wang,Z.T., Raymond,J., Mimuro,M.,
RA   Blankenship,R.E. and Touchman,J.W.;
RT   "Niche adaptation and genome expansion in the chlorophyll d-producing
RT   cyanobacterium Acaryochloris marina";
RL   Proc. Natl. Acad. Sci. U.S.A. 105 (6), 2005-2010 (2008)
XX
RN   [2]
RP   1-356087
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (17-OCT-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-356087
RA   Touchman,J.;
RT   "Direct Submission";
RL   Submitted (25-SEP-2007) Translational Genomics Research Institute, 13208 E
RL   Shea Blvd, Scottsdale, AZ 85004, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000839.
CC   Source bacteria from Marine Biotechnology Institute Culture
CC   Collection, Marine Biotechnology Institute, 3-75-1 Heita, Kamaishi,
CC   Iwate 026-0001, Japan.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..356087
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:329726"
FT                   /note="type strain of Acaryochloris marina"
FT                   /strain="MBIC11017"
FT                   /plasmid="pREB2"
FT                   /organism="Acaryochloris marina MBIC11017"
FT   gene            66..1211
FT                   /db_xref="GeneID:5685626"
FT                   /locus_tag="AM1_B0001"
FT   CDS_pept        66..1211
FT                   /locus_tag="AM1_B0001"
FT                   /gene_family="HOG000023053" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339872"
FT                   /db_xref="GeneID:5685626"
FT                   /translation="MDNSIRIPLNLPDIRVLELSKTERGDWLIKIESTLQGTTCHQCGR
FT                   EITDLHCHDQPFRIRHLPLFEVPVYLEIRPKRYRCKYCDDHPTTTQHLEWHEPRSPNTK
FT                   AYERWLLRILINSTVSDVARKLGVSEDIVSGIIDRWIAAQVDWSEYADLKVMGMDEISL
FT                   KRGHRDFVVLITIPTTDGVDILAVLADRKQQTVANFLQSIPIDLRQTIERVCTDMYQGF
FT                   VSAVREQLPQAKIVIDRFHVTKAYRNCADTVRKREVKRLRRELSKQEYDSIKGAMWPFR
FT                   KRPENLKESEQQLLERLFAYSPQLKQAYNLREKLTQIFEGRYTKHGAKCAIRAWCKQVL
FT                   KSDIKEFDCFLTTINNWMDEMTNYFLEGWTSGFVEYWMSTP"
FT                   /protein_id="YP_001521042.1"
FT   misc_feature    66..1190
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3464"
FT                   /db_xref="CDD:33267"
FT                   /locus_tag="AM1_B0001"
FT   misc_feature    528..797
FT                   /note="Transposase; Region: Transposase_12; pfam01610"
FT                   /db_xref="CDD:110601"
FT                   /locus_tag="AM1_B0001"
FT   gene            complement(1369..2100)
FT                   /db_xref="GeneID:5685640"
FT                   /locus_tag="AM1_B0002"
FT   CDS_pept        complement(1369..2100)
FT                   /locus_tag="AM1_B0002"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /transl_table="11"
FT                   /note="Upstream region overlaps with a putative
FT                   transposase."
FT                   /db_xref="GI:158339873"
FT                   /db_xref="GeneID:5685640"
FT                   /translation="MLTHWESIESQAMQENWSYAEFLLALCETEAQRREQARLKRALTE
FT                   ARLPNAKSFTNFDFSHCPQLNPAPLMQLAADPGWLERAENCLILGPSGVGKTHLATGVS
FT                   KKMLEFGKRVKFFAANALVQQLQQAKLQLQLHPMLKKLDRYDLLILDDLGYCKKSEAET
FT                   SVLFELIAHRYERKSLLITANQPFSQWDDIFTDSMMAVAAIDRLIHHGLIIEIQADSYR
FT                   RKSATQRTAQTQSQPQKSQSK"
FT                   /protein_id="YP_001521043.1"
FT   misc_feature    complement(1459..1995)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="AM1_B0002"
FT   gene            complement(1928..3664)
FT                   /db_xref="GeneID:5685641"
FT                   /locus_tag="AM1_B0003"
FT   CDS_pept        complement(1928..3664)
FT                   /locus_tag="AM1_B0003"
FT                   /gene_family="HOG000139033" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase, putative"
FT                   /transl_table="11"
FT                   /note="Downstream region overlaps with a putative
FT                   transposase-associated ATP-binding protein."
FT                   /db_xref="GI:158339874"
FT                   /db_xref="GeneID:5685641"
FT                   /translation="MPNKRIDSYHTRVYMNGRDLGLKQADAAYIAEISTRTGQRIEAGT
FT                   HQPNRGRLQDQRTVPDPLADVWEDELEPMLRRDPRLKPMTLYEYLQDKYPGQYPQVLRT
FT                   LQRRVRTWKALHGPSPEVMFELRHEPGVQGFSDFTELKGITITIAGKPFEHLIYHYRLG
FT                   YSGWRYAQIIEGGESFVALSEGLQNAFAACGGVPTQHRTDSLSAAYRNMGGRRSKNLTR
FT                   LYDELCDHYRLEPTRNNKGVAHENGSIESPHGHLKNRIKQAIYLRGSADFTSVAEYQAL
FT                   IDAQVAKLNQQCQTKYEQEKDHLQPLPKYRTPDYEVLTAKVSKRSTIDVRCILYTVPSR
FT                   LIGRQLELHLYHDRIVGYLERHPVVELPRKRVSGKGKRRDRCINYRHVIGSMRLKPRAF
FT                   IYCTWQSDLLPNPEYRQIWEQLKAQFDLEQAAKIIVEALYIAAVQDKEQAVAVYLQQQL
FT                   RSSSLTLNRLKKQFEPPQMKQVPELSIEQHSLELYDKLLPSCSVPAEPLPAPEPLFKKA
FT                   QALPHVDPLGIYRIPSHAGKLVLCGILTSLVRNGGPTKRTSSSKTCPHRSQAPKRKKFY
FT                   QL"
FT                   /protein_id="YP_001521044.1"
FT   misc_feature    complement(2885..3286)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="AM1_B0003"
FT   gene            3860..3985
FT                   /db_xref="GeneID:5685642"
FT                   /locus_tag="AM1_B0004"
FT   CDS_pept        3860..3985
FT                   /locus_tag="AM1_B0004"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339875"
FT                   /db_xref="GeneID:5685642"
FT                   /translation="MEGFNNRVKVLKRRCYGIFDIERLFQRISLDLNGYQTFAVT"
FT                   /protein_id="YP_001521045.1"
FT   gene            4089..4343
FT                   /note="fragment; similar to C-terminus of transposase"
FT                   /db_xref="GeneID:5685643"
FT                   /locus_tag="AM1_B0005"
FT   gene            4356..5213
FT                   /db_xref="GeneID:5685644"
FT                   /locus_tag="AM1_B0006"
FT   CDS_pept        4356..5213
FT                   /locus_tag="AM1_B0006"
FT                   /gene_family="HOG000113194" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339876"
FT                   /db_xref="GeneID:5685644"
FT                   /translation="MQAMIEQLQHMKLTGLLEAWREQQALPTYHDLSFDERLALMVERE
FT                   YIRRQNQRMQRRLRQARLPVHATLDAVDFDVPRGLKKIQFLEFAQGHWLQENLSLIFLG
FT                   PTGVGKSFLAAVLAHHLCKQGHTVRYIKTADLLLELKLTKADGSYPKLRKQLAAYDLLV
FT                   LDEWLRDPLSLYEAREILDVLDERFRKASCLFATQIPVEQWHPQIQDPTLADAILDRIV
FT                   HDAMKVSLRGESMRKLTSKLIPQKENDNPALSTKQQENKTDAKPKNETSAKSKAKGLQE
FT                   TTDD"
FT                   /protein_id="YP_001521046.1"
FT   misc_feature    4356..5066
FT                   /note="DNA replication protein [DNA replication,
FT                   recombination, and repair]; Region: DnaC; COG1484"
FT                   /db_xref="CDD:31673"
FT                   /locus_tag="AM1_B0006"
FT   misc_feature    4416..4490
FT                   /note="IstB-like ATP binding N-terminal; Region: IstB_N;
FT                   pfam08483"
FT                   /db_xref="CDD:117060"
FT                   /locus_tag="AM1_B0006"
FT   misc_feature    4614..5021
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="AM1_B0006"
FT   misc_feature    4665..4688
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="AM1_B0006"
FT   misc_feature    order(4668..4691,4848..4850,4947..4949)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="AM1_B0006"
FT   misc_feature    4836..4853
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="AM1_B0006"
FT   misc_feature    5001..5003
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="AM1_B0006"
FT   gene            complement(5229..5342)
FT                   /db_xref="GeneID:5685645"
FT                   /locus_tag="AM1_B0007"
FT   CDS_pept        complement(5229..5342)
FT                   /locus_tag="AM1_B0007"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339877"
FT                   /db_xref="GeneID:5685645"
FT                   /translation="MLRHLPIKKYRHLELAGQKVSLYLNQMALELPKSFIT"
FT                   /protein_id="YP_001521047.1"
FT   gene            complement(5430..7103)
FT                   /db_xref="GeneID:5685646"
FT                   /locus_tag="AM1_B0008"
FT   CDS_pept        complement(5430..7103)
FT                   /locus_tag="AM1_B0008"
FT                   /gene_family="HOG000121685" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339878"
FT                   /db_xref="GeneID:5685646"
FT                   /translation="MELFQQFLPCQDTLHLDSWDLDSTNHQMTFHVSSTQALACCPVCH
FT                   QTSHRVHSRYERTLRDLPCVEFCLTILLQVCKFFCSNKTCKRRIFTERLPQVAVPWARR
FT                   TVRFAEHLSSIGLALGGAAAARLSYQINYGSSRNTMLRALFKLPLPSVTTPKILGVDDF
FT                   ALRRGHEYGTILVDLEKHQPIVLLTDRKADTLADWLNEHPGVEVISRDRSKAYKSGASE
FT                   GAPDALQVADRFHLLQNLEEILENVFSSHSQVIKTVEYTLLKATLAEHQDTEAMSQPVV
FT                   KPQVDPNSRKAQNRARRLEKYEQTHALRKQGYLIKDIAHHLGIGKRTVYTYLAADTFQE
FT                   YKTHPRRGWSGLNPYKAYLLEQWNKGRQNSKQLLAEIQQQGFKGSYTMVVRYTHKLRQS
FT                   LPPQPPRDSLNELPGRGPVPEAQELIQKPLTVQRAAWLVMRKVENLTEEDETILEQLSS
FT                   QPELSKAIDLAQSLLFIVRKRLPQHLDPWLDRAKNSALKPFQSFAKGLLDDYEAVKAAL
FT                   TLEVSNGQVEGQNNRLKMVKRQMYGRAGLDLLNKRLVLMS"
FT                   /protein_id="YP_001521048.1"
FT   misc_feature    complement(<6390..6983)
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3464"
FT                   /db_xref="CDD:33267"
FT                   /locus_tag="AM1_B0008"
FT   misc_feature    complement(6351..6635)
FT                   /note="Transposase; Region: Transposase_12; pfam01610"
FT                   /db_xref="CDD:110601"
FT                   /locus_tag="AM1_B0008"
FT   misc_feature    complement(5439..6608)
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3464"
FT                   /db_xref="CDD:33267"
FT                   /locus_tag="AM1_B0008"
FT   gene            complement(7195..7308)
FT                   /db_xref="GeneID:5685647"
FT                   /locus_tag="AM1_B0009"
FT   CDS_pept        complement(7195..7308)
FT                   /locus_tag="AM1_B0009"
FT                   /gene_family="HOG000023154" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339879"
FT                   /db_xref="GeneID:5685647"
FT                   /translation="MIESWRCIDIRNQVIIRRQIFNHPKYPAGKSLKSSPI"
FT                   /protein_id="YP_001521049.1"
FT   gene            complement(7423..7998)
FT                   /db_xref="GeneID:5685648"
FT                   /locus_tag="AM1_B0010"
FT   CDS_pept        complement(7423..7998)
FT                   /locus_tag="AM1_B0010"
FT                   /gene_family="HOG000023155" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339880"
FT                   /db_xref="GeneID:5685648"
FT                   /translation="MPNTSRTKRVMIMNQTVPQQPGPKERAKAGFGIVDEMLKAYNGGE
FT                   TYVKRFLTFVGIGGVITGTALGYRPHVSPQAPQAEPIIIQMTPPTSLPATSPAKPESSP
FT                   AKPAEPSTTQPVAEIQPEPSQKTPPSQPNVRPAPLPKPVIATQPVPSHVTVQKPSIVIT
FT                   PPILKRPAPSLPFEVDQSDQDDRFEIDD"
FT                   /protein_id="YP_001521050.1"
FT   gene            8279..10009
FT                   /db_xref="GeneID:5685649"
FT                   /locus_tag="AM1_B0012"
FT   CDS_pept        8279..10009
FT                   /locus_tag="AM1_B0012"
FT                   /gene_family="HOG000139033" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase, putative"
FT                   /transl_table="11"
FT                   /note="Downstream region overlaps with a putative
FT                   transposase-associated ATP-binding protein."
FT                   /db_xref="GI:158339882"
FT                   /db_xref="GeneID:5685649"
FT                   /translation="MPAPIKPQQVHLYMQTKQSGSSQETAAAKAGISTRTAHRIDSGTH
FT                   RPQRGRPHDWKTREDPLDGLWELELEPMLEREPRLEATTLFETLQENHPGQYDDKIRTV
FT                   QRRTAKWKAAHGKPKEVMFKIQHHPGEMGQSDFAQLKGFSVTVQGEAFHHILYHYRLSY
FT                   SGWQYVQVIQGGESFIGLSQGLQNALTACGGVPKIHRTDSLSAAYRNTGGRNPQLTQLY
FT                   STLCDHYRMQPTRNNLGVSHENGGIEGSHGYFKRRLCQALYRRGSFDFESVAAYQQFIE
FT                   QVIAKLNAKCQKKFALELPTLQPLPRYRTPDYEVRSAKVSCNSTIAVRCVLYTVPSRLI
FT                   GHRLKLHLYHDRIVGFLGTTPVVELARVHVHGSEKKRRARSIDYKHVAESLRRKPNAFL
FT                   YCQWQSELLPNLQWHQLWESLKASFERDQAARLITEALYIAATQDQESQVADYLQTQLD
FT                   QSTLTLSGLKQAFEFQLSTEQYPDVPSQQHNLSDYDQFLTLGSGQPIPVADDNPQTAPV
FT                   KTFPRRVAEHRASSNSGELVLRPVSIGFSSRRSQPPRTESDLPRAVRSATSLRKILDQF
FT                   "
FT                   /protein_id="YP_001521051.1"
FT   misc_feature    8651..9052
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="AM1_B0012"
FT   gene            9804..10553
FT                   /db_xref="GeneID:5685651"
FT                   /locus_tag="AM1_B0013"
FT   CDS_pept        9804..10553
FT                   /locus_tag="AM1_B0013"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /transl_table="11"
FT                   /note="Upstream region overlaps with a putative
FT                   transposase."
FT                   /db_xref="GI:158339883"
FT                   /db_xref="GeneID:5685651"
FT                   /translation="MTTLKQLRLRHFLDEWQSIEHQATQENWSYAQFLLALAQGEASRR
FT                   EQNRISRALSEAQLPYGKSWTNFEFDHIPSLNPAALMEFSQTTHWLESGSNILIFGPSG
FT                   TGKTHVSSALGTSMIELGKRVKFLTATALVQQLQLAKLQLELQSLLSKLDRYDLLIIDD
FT                   LGYVQKSDVETSVLFELIAHRYERKSLLITANQPFSQWDKIFPNSMMTVAAIDRLIHHA
FT                   TIFEMQAESFRKQEAAKHTAKSQKTDR"
FT                   /protein_id="YP_001521052.1"
FT   misc_feature    9813..10505
FT                   /note="DNA replication protein [DNA replication,
FT                   recombination, and repair]; Region: DnaC; COG1484"
FT                   /db_xref="CDD:31673"
FT                   /locus_tag="AM1_B0013"
FT   misc_feature    9942..10478
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="AM1_B0013"
FT   gene            complement(9983..10156)
FT                   /db_xref="GeneID:5685652"
FT                   /locus_tag="AM1_B0011"
FT   CDS_pept        complement(9983..10156)
FT                   /locus_tag="AM1_B0011"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339881"
FT                   /db_xref="GeneID:5685652"
FT                   /translation="MEVPKAELTCVFPVPLGPKIRMLLPDSNQWVVWENSIRAAGLRLG
FT                   IWSNSKLVQDFP"
FT                   /protein_id="YP_001521053.1"
FT   gene            10695..10817
FT                   /db_xref="GeneID:5685650"
FT                   /locus_tag="AM1_B0014"
FT   CDS_pept        10695..10817
FT                   /locus_tag="AM1_B0014"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339884"
FT                   /db_xref="GeneID:5685650"
FT                   /translation="MHDGIAKTKLDSRAIIKSMKTEQKKLAYLIDIRHLAMKSM"
FT                   /protein_id="YP_001521054.1"
FT   gene            complement(11018..12238)
FT                   /db_xref="GeneID:5685653"
FT                   /locus_tag="AM1_B0015"
FT   CDS_pept        complement(11018..12238)
FT                   /locus_tag="AM1_B0015"
FT                   /gene_family="HOG000234302" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TPR domain-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339885"
FT                   /db_xref="GeneID:5685653"
FT                   /translation="MRSLNSPAPLALGVIAFVFIPLPTAIALTATDVSAIAEAITVRID
FT                   GQNPGSGVLIKHQGNTYTVLTASHVVATEDTYELVTFDDQRYPLNYNRIQKFPGIDLAV
FT                   VKFTSTISYRVAKLGDSSEVKAGESIYVSGFSTPTKAITEAIWNFSKGEVTSNTKRPLA
FT                   DGYGLVYSNNTLPGMSGGAILNRQGRLIGIHGRADAEQQVQQSATVHIKSGFNLGIPIN
FT                   TFLNLTNNTSQKLSDVDPPIAAKGSELKADDWYLQATHRSKKGDFLGAISDLDKAIELD
FT                   PDYVIAYFRRGTARLNLKEYPKTIADLNKVIELDPEFAAAYVSRGISYTYLMKYSRAFS
FT                   DYNKAIELNREFAAAYAIRGATYVLIGNLTQGKQDIQTAAQLFKQQNIPEGYEMTINFL
FT                   KQPEFSR"
FT                   /protein_id="YP_001521055.1"
FT   misc_feature    complement(11657..12085)
FT                   /note="Trypsin-like serine protease; Many of these are
FT                   synthesized as inactive precursor zymogens that are cleaved
FT                   during limited proteolysis to generate their active forms.
FT                   Alignment contains also inactive enzymes that have
FT                   substitutions of the catalytic...; Region: Tryp_SPc;
FT                   cl00149"
FT                   /db_xref="CDD:153545"
FT                   /locus_tag="AM1_B0015"
FT   misc_feature    complement(11186..11485)
FT                   /note="Tetratricopeptide repeat domain; typically contains
FT                   34 amino acids
FT                   [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
FT                   X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a
FT                   variety of organisms including bacteria, cyanobacteria,
FT                   yeast, fungi...; Region: TPR; cd00189"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_B0015"
FT   misc_feature    complement(order(11243..11248,11255..11260,11267..11272,
FT                   11348..11353,11360..11365,11369..11374,11459..11464,
FT                   11471..11476,11480..11485))
FT                   /note="binding surface"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_B0015"
FT   misc_feature    complement(order(11204..11206,11213..11215,11225..11227,
FT                   11261..11263,11306..11308,11315..11317,11327..11329,
FT                   11363..11365,11408..11410,11417..11419,11429..11431,
FT                   11465..11467))
FT                   /note="TPR motif; other site"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AM1_B0015"
FT   gene            complement(12573..13772)
FT                   /db_xref="GeneID:5685654"
FT                   /locus_tag="AM1_B0016"
FT   CDS_pept        complement(12573..13772)
FT                   /locus_tag="AM1_B0016"
FT                   /gene_family="HOG000215687" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339886"
FT                   /db_xref="GeneID:5685654"
FT                   /translation="MKESLSIQQARKLVLLSQRLPPRNQSGRAIEATLSAIEHLGYIQI
FT                   DTISVVQRAHHHTLWNRNPRYKASQLDQLLSDKQVFEYWSHAAAYLPFRDYRFSLPRKY
FT                   AFASGDQRHWYQRDEQMLKWVLKRIATEGPLMAKDFEHSGTRIGAWKTKPAKRALEYLF
FT                   MQGDLMVPYRINFHKVYDLTERVLPEGTDTTLPTPEEYARFLITRYLRGNGLGLSAEIT
FT                   YLLKGIKPLVDKTLEDMVSTGELLQIRVAGRLYYAFPTSLELLSKSLARSKLKILSPFD
FT                   NLVIQRKRIKALFDFDYLIECYVPEAKRRYGYFSLPILWDGKLVARMDCRTERAESLLH
FT                   IYHLALEPTVLKTEVLFPALRKELESFLQFNHCDQLRLHRTSPAQAKPELQTLINDLTI
FT                   "
FT                   /protein_id="YP_001521056.1"
FT   misc_feature    complement(12663..13772)
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   [Function unknown]; Region: COG3214"
FT                   /db_xref="CDD:33027"
FT                   /locus_tag="AM1_B0016"
FT   misc_feature    complement(12663..13766)
FT                   /note="Protein of unknown function (DUF1006); Region:
FT                   DUF1006; pfam06224"
FT                   /db_xref="CDD:148057"
FT                   /locus_tag="AM1_B0016"
FT   gene            complement(13869..15218)
FT                   /db_xref="GeneID:5685655"
FT                   /locus_tag="AM1_B0017"
FT   CDS_pept        complement(13869..15218)
FT                   /locus_tag="AM1_B0017"
FT                   /gene_family="HOG000023156" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PAS domain-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339887"
FT                   /db_xref="GeneID:5685655"
FT                   /translation="MQSTDVVIPLQSEWDYTQKFLQALLDNLSNGIVACNNQGVLTLFN
FT                   SSAQELHGLPLCPIPAEQWASYYHLYQADGTTSLPQDDIPLYRALQGESVHNAEIVVKP
FT                   SQGKPRTILASGDPIIAQDGQKLGAVVAIQDITLRKQAELELGKSEERWQLALEGTGDG
FT                   LFDWNIVTNEAFMSLQLKQTLGYADHEVENSFEGWRQLVHPDDLGEVAAAIEAHLRQSM
FT                   PRYTAEYRMRCKDGSYKWILARGQTKWDDNGQPIRMIGSHQDITRQKQAEMELARLNRD
FT                   LEERVTSRTTQLEVAKNQKEALVVKEQEARRQSKIDRAGIKLYESIISNIQLGILVWHS
FT                   QNLESEEHLELVSTNPAAESILKMKLHEEIGRQMSDIFPSFVEKHPEILLSLVEIIRTQ
FT                   HPRSIENVPYTFPEGDENLFSLRAFPLPNDCVGVAFENVTVQETTEPTFS"
FT                   /protein_id="YP_001521057.1"
FT   misc_feature    complement(14811..15164)
FT                   /note="PAS fold; Region: PAS; pfam00989"
FT                   /db_xref="CDD:144544"
FT                   /locus_tag="AM1_B0017"
FT   misc_feature    complement(14811..15137)
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="AM1_B0017"
FT   misc_feature    complement(order(14898..14900,14913..14915,14991..14993,
FT                   15012..15020,15057..15059,15075..15077,15087..15089))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="AM1_B0017"
FT   misc_feature    complement(order(14871..14873,14877..14879,14961..14966,
FT                   14973..14975,15015..15017,15027..15029))
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="AM1_B0017"
FT   misc_feature    complement(14424..14741)
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="AM1_B0017"
FT   misc_feature    complement(14433..14696)
FT                   /note="PAS fold; Region: PAS_3; pfam08447"
FT                   /db_xref="CDD:117024"
FT                   /locus_tag="AM1_B0017"
FT   misc_feature    complement(order(14511..14513,14526..14528,14607..14618,
FT                   14661..14663,14679..14681,14691..14693))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="AM1_B0017"
FT   misc_feature    complement(order(14484..14486,14490..14492,14577..14582,
FT                   14589..14591,14613..14615,14625..14627))
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="AM1_B0017"
FT   gene            complement(15197..15592)
FT                   /db_xref="GeneID:5685656"
FT                   /locus_tag="AM1_B0018"
FT   CDS_pept        complement(15197..15592)
FT                   /locus_tag="AM1_B0018"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339888"
FT                   /db_xref="GeneID:5685656"
FT                   /translation="MTSGPEFPFSSDSVLSETSGDKQHALQLKPQQLLDRLPVTVWQAN
FT                   DQGQIISLSARWQLITGHAPIESLGEAFWNAVLLEDRDLSFQQWTNACQQQQPFVLHLH
FT                   LCSIKGKPDPFLIQGVAGWVRCSQRML"
FT                   /protein_id="YP_001521058.1"
FT   gene            complement(15686..16039)
FT                   /db_xref="GeneID:5685657"
FT                   /locus_tag="AM1_B0019"
FT   CDS_pept        complement(15686..16039)
FT                   /locus_tag="AM1_B0019"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339889"
FT                   /db_xref="GeneID:5685657"
FT                   /translation="MQMAPPFLVENTAMLNHPTPLFDKLCEVTGYTLLDLAVFAKDEGY
FT                   PLMPILLSPFQKIQLRNIVLCHWAIKEGYFTSWSHAEVEFIKLWGKVKEIDLIGAWVDY
FT                   CHDRELISQGMVC"
FT                   /protein_id="YP_001521059.1"
FT   gene            16336..16674
FT                   /db_xref="GeneID:5685658"
FT                   /locus_tag="AM1_B0020"
FT   CDS_pept        16336..16674
FT                   /locus_tag="AM1_B0020"
FT                   /gene_family="HOG000023157" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339890"
FT                   /db_xref="GeneID:5685658"
FT                   /translation="MIKKMSPNNFNTRASKTSDKNDNLCSGWWLEVGTANPPCIDFYGP
FT                   FEGKAEAEVAKLEYVQKSTKTSQIVFSHSKFCQPRQRTLTQNDFTIQDLKDCPPTFFKV
FT                   VLGGHRIY"
FT                   /protein_id="YP_001521060.1"
FT   misc_feature    16417..16557
FT                   /note="Domain of unknown function (DUF1816); Region:
FT                   DUF1816; pfam08846"
FT                   /db_xref="CDD:149792"
FT                   /locus_tag="AM1_B0020"
FT   gene            16805..16921
FT                   /db_xref="GeneID:5685659"
FT                   /locus_tag="AM1_B0021"
FT   CDS_pept        16805..16921
FT                   /locus_tag="AM1_B0021"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339891"
FT                   /db_xref="GeneID:5685659"
FT                   /translation="MLTMQQVNQIFHKVTADSVRCGALTIFAVAQALFIGVM"
FT                   /protein_id="YP_001521061.1"
FT   gene            16955..17710
FT                   /db_xref="GeneID:5685660"
FT                   /locus_tag="AM1_B0022"
FT   CDS_pept        16955..17710
FT                   /locus_tag="AM1_B0022"
FT                   /gene_family="HOG000017870" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339892"
FT                   /db_xref="GeneID:5685660"
FT                   /translation="MKQVAKSSKSLKFLITDIGVMKLNWFKFLPLSACLLLCIFPRNAM
FT                   ALESHDEVQESTKVFTEINREPKTRIPSSLLQRSQAIAILTNVTQGGFIFGVRRGDGVI
FT                   LIRKPNGGWSNPAFITITGGSFGLQAGARSSDVILVFPSQTALKTVLSEAFEFGGSVSG
FT                   TAGPVGEQPVESLEGFNGDKVYTYSRSEGLFGGVTLEGSDLDDDDGLNKEFYGQPITAT
FT                   QIFQRSSMQAPVVVDSLKQVLQQAEAGIR"
FT                   /protein_id="YP_001521062.1"
FT   misc_feature    17075..17695
FT                   /note="Family of unknown function (DUF500); Region: DUF500;
FT                   cl01109"
FT                   /db_xref="CDD:154201"
FT                   /locus_tag="AM1_B0022"
FT   gene            17838..18182
FT                   /db_xref="GeneID:5685661"
FT                   /locus_tag="AM1_B0023"
FT   CDS_pept        17838..18182
FT                   /locus_tag="AM1_B0023"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphoribosyltransferase like protein, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339893"
FT                   /db_xref="GeneID:5685661"
FT                   /translation="MVITLPRGGVPVAFEIAKELNAPLDLCLVRKLGVPGMNELAMGAI
FT                   TSDGVILLNDEVVSELDISPQIIEQVATNEMRELCRQAYLYQGDRQPSRIHDHILILVD
FT                   DDGIATATTI"
FT                   /protein_id="YP_001521063.1"
FT   misc_feature    17838..>18113
FT                   /note="Phosphoribosyl transferase domain; Region:
FT                   Pribosyltran; cl00309"
FT                   /db_xref="CDD:174099"
FT                   /locus_tag="AM1_B0023"
FT   gene            18195..18413
FT                   /db_xref="GeneID:5685662"
FT                   /locus_tag="AM1_B0024"
FT   CDS_pept        18195..18413
FT                   /locus_tag="AM1_B0024"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphoribosyltransferase like protein, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339894"
FT                   /db_xref="GeneID:5685662"
FT                   /translation="MLQKQQPCQIVVASPVIEAGTYETLKTEVEEVVFLINPKPLYSIG
FT                   FWHEDFSQTSDEELKQLLAIKYRSKYR"
FT                   /protein_id="YP_001521064.1"
FT   misc_feature    <18198..18386
FT                   /note="Phosphoribosyl transferase domain; Region:
FT                   Pribosyltran; cl00309"
FT                   /db_xref="CDD:174099"
FT                   /locus_tag="AM1_B0024"
FT   gene            complement(18459..18716)
FT                   /db_xref="GeneID:5685663"
FT                   /locus_tag="AM1_B0025"
FT   CDS_pept        complement(18459..18716)
FT                   /locus_tag="AM1_B0025"
FT                   /gene_family="HOG000232811" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339895"
FT                   /db_xref="GeneID:5685663"
FT                   /translation="MMTTLLSFLADLSNHLGLAWWVEIKTLSPICTYFFGPFLIRKEAE
FT                   AALFGYVEDLEAEQAQNIVAHIQRCHPPHLTICNEMEYSC"
FT                   /protein_id="YP_001521065.1"
FT   misc_feature    complement(18486..18683)
FT                   /note="Domain of unknown function (DUF1816); Region:
FT                   DUF1816; pfam08846"
FT                   /db_xref="CDD:149792"
FT                   /locus_tag="AM1_B0025"
FT   gene            18916..19044
FT                   /db_xref="GeneID:5685664"
FT                   /locus_tag="AM1_B0026"
FT   CDS_pept        18916..19044
FT                   /locus_tag="AM1_B0026"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339896"
FT                   /db_xref="GeneID:5685664"
FT                   /translation="MIDHQICVQGFWQIMVATGDIAIVPIFSNDKGTTITSIQLKR"
FT                   /protein_id="YP_001521066.1"
FT   gene            19206..19853
FT                   /db_xref="GeneID:5685665"
FT                   /locus_tag="AM1_B0027"
FT   CDS_pept        19206..19853
FT                   /locus_tag="AM1_B0027"
FT                   /gene_family="HOG000019423" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CobQ/CobB/MinD/ParA family protein"
FT                   /transl_table="11"
FT                   /note="CobQ/CobB/MinD/ParA nucleotide binding domain
FT                   (PF01656 and COG1192)"
FT                   /db_xref="GI:158339897"
FT                   /db_xref="GeneID:5685665"
FT                   /translation="MQTPKIIAFANQKGGSGKSTSAAHAAYWLAQKGLSVLLVDADGQQ
FT                   SSSAWLNELELDYQVLIDPEQLFESLPTFSDDYDVVVVDGPGSLSEVTKAILSRCDLVL
FT                   VPTRDSIIDLRSTGKIVQFIKHAKELRGGFPKAAIFLNATRKSSVLLREAQEALEDVVI
FT                   PLMQTVIYDRQCIKDAPGQGSTVFKMKGKPAKEASKNYEELFTEAMEIFGND"
FT                   /protein_id="YP_001521067.1"
FT   misc_feature    19218..19835
FT                   /note="ParA-like protein; Provisional; Region: PHA02518"
FT                   /db_xref="CDD:134018"
FT                   /locus_tag="AM1_B0027"
FT   misc_feature    19221..19631
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="AM1_B0027"
FT   misc_feature    19242..19262
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="AM1_B0027"
FT   misc_feature    order(19260..19262,19392..19394)
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="AM1_B0027"
FT   gene            19846..20796
FT                   /db_xref="GeneID:5685666"
FT                   /locus_tag="AM1_B0028"
FT   CDS_pept        19846..20796
FT                   /locus_tag="AM1_B0028"
FT                   /gene_family="HOG000088074" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ParB family chromosome partitioning protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339898"
FT                   /db_xref="GeneID:5685666"
FT                   /translation="MTRRTLKKAIQADNQLSDFVFGNVEVADGDLKYIPLNSIKRTTLQ
FT                   QRRYFDQKQIEEWAKHEIKINGIRSPLWVRKLPKSNRKQEYELVAGERRYRAAEFLNLL
FT                   EVPVRIFILDDRQALMASLVENMQRQDLSPLEETEGTLEFLSMELDLPIEKVTKFLYQM
FT                   NNASKGTVNQNVLVSDNAHKVENVFKVLGRLTWTSFVSSRLPLLKNPSDILNALRSGEI
FT                   EYTKAMAISKLKDKKTRVKILKKAINESLSLTEIKQLINSYREPVDQPTELSLDTEVKK
FT                   ALAKFKKSKVWTNPKKEKQIRRLLQQLDKLMDDDN"
FT                   /protein_id="YP_001521068.1"
FT   misc_feature    19939..20223
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="AM1_B0028"
FT   misc_feature    19984..>20634
FT                   /note="PRTRC system ParB family protein; Region:
FT                   PRTRC_parB; TIGR03734"
FT                   /db_xref="CDD:163446"
FT                   /locus_tag="AM1_B0028"
FT   gene            complement(21008..21646)
FT                   /db_xref="GeneID:5685667"
FT                   /locus_tag="AM1_B0029"
FT   CDS_pept        complement(21008..21646)
FT                   /locus_tag="AM1_B0029"
FT                   /gene_family="HOG000147597" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339899"
FT                   /db_xref="GeneID:5685667"
FT                   /translation="MSIDCKATVELGESSRRGKTRTQTKACDHDMGSGPKYVPCGILEE
FT                   DADTLHIIFGHSHKTSDFMVDNLQDWWNTLAPTEQQTLQLIQIKLDIGPENSGVRTQFL
FT                   NRLVAFSDHIGTAIQLLYYPPYHSKYNPIERCWGILEQHWNGTLLTDVDTLLGWASTMT
FT                   WKGNHPVVTVTQKIYETGISLTKQAMKGIEKRLERHPQLPKWDILIHPI"
FT                   /protein_id="YP_001521069.1"
FT   misc_feature    complement(21014..>21643)
FT                   /note="Rhodopirellula transposase; Region: Transposase_36;
FT                   pfam07592"
FT                   /db_xref="CDD:148936"
FT                   /locus_tag="AM1_B0029"
FT   gene            complement(21673..22149)
FT                   /db_xref="GeneID:5685668"
FT                   /locus_tag="AM1_B0030"
FT   CDS_pept        complement(21673..22149)
FT                   /locus_tag="AM1_B0030"
FT                   /gene_family="HOG000023040" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339900"
FT                   /db_xref="GeneID:5685668"
FT                   /translation="MTGARRRAFQADIALKYCDGNPNLTEIIFGWGRNTVATGLGEKRT
FT                   GMICVGAQSGFCGRKRWEDLHPEVAAALRELAEAHCQQDPTFSSSTAYTRLTAAAAITH
FT                   LRAQGFPPKSVPAKSTMAVVLNRLGYRLRRVLKAKPPKNCRKPMPSLPTSNTKT"
FT                   /protein_id="YP_001521070.1"
FT   misc_feature    complement(<21730..21900)
FT                   /note="Rhodopirellula transposase; Region: Transposase_36;
FT                   pfam07592"
FT                   /db_xref="CDD:148936"
FT                   /locus_tag="AM1_B0030"
FT   gene            22328..22471
FT                   /db_xref="GeneID:5685669"
FT                   /locus_tag="AM1_B0031"
FT   CDS_pept        22328..22471
FT                   /locus_tag="AM1_B0031"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339901"
FT                   /db_xref="GeneID:5685669"
FT                   /translation="MRYSTPDSEGAENIAVYVPAFSPIMFIKTDDMLRQQQYFNFKSLY
FT                   LA"
FT                   /protein_id="YP_001521071.1"
FT   gene            22497..22967
FT                   /db_xref="GeneID:5685670"
FT                   /locus_tag="AM1_B0032"
FT   CDS_pept        22497..22967
FT                   /locus_tag="AM1_B0032"
FT                   /gene_family="HOG000089968" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339902"
FT                   /db_xref="GeneID:5685670"
FT                   /translation="MEKPAIEHYWQSYCQTLSPDEDLDQPYLVEQFGDSPEMANELGQL
FT                   VLAGTKTATCSALWEWEAEHSPLPTVGLKTIVVDGSETPFCIIETTEVNICPFDQIDAQ
FT                   FAYDEGEDDRTLESWQREHWKYFSRALPKIDKEPTHNMLLVCERFQIVYRTH"
FT                   /protein_id="YP_001521072.1"
FT   misc_feature    22575..22955
FT                   /note="ASC-1 homology domain, subfamily similar to
FT                   Enterococcus faecalis Ef3133. The ASCH domain, a small
FT                   beta-barrel domain found in all three kingdoms of life,
FT                   resembles the RNA-binding PUA domain and may also interact
FT                   with RNA. ASCH has been proposed to...; Region:
FT                   ASCH_Ef3133_like; cd06553"
FT                   /db_xref="CDD:119345"
FT                   /locus_tag="AM1_B0032"
FT   gene            22992..23510
FT                   /db_xref="GeneID:5685671"
FT                   /locus_tag="AM1_B0033"
FT   CDS_pept        22992..23510
FT                   /locus_tag="AM1_B0033"
FT                   /gene_family="HOG000279010" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acetyltransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339903"
FT                   /db_xref="GeneID:5685671"
FT                   /translation="MKRIQLASESDVLALANLYRQTVLTWGPRYYTPAQVTAWASFTSE
FT                   TDQFRAFILQATTFVARNHTGILGFAGIAEDGHVTSAYVRQDCIHQGIGSALMRNLLEY
FT                   AQSRCIQRLYAEASEFSLGLFKKFGFQLYETEMVERHGVQFQRFLVELKLNDQRRHCRN
FT                   DSGLPHDCG"
FT                   /protein_id="YP_001521073.1"
FT   misc_feature    22992..23465
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:176420"
FT                   /locus_tag="AM1_B0033"
FT   gene            23497..23658
FT                   /db_xref="GeneID:5685672"
FT                   /locus_tag="AM1_B0034"
FT   CDS_pept        23497..23658
FT                   /locus_tag="AM1_B0034"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339904"
FT                   /db_xref="GeneID:5685672"
FT                   /translation="MIVDETAEPEDDPVLAPYRKLVLSNIALSHSWNQPGYLAHPKHYN
FT                   PLISYAIT"
FT                   /protein_id="YP_001521074.1"
FT   gene            23691..24281
FT                   /db_xref="GeneID:5685673"
FT                   /locus_tag="AM1_B0035"
FT   CDS_pept        23691..24281
FT                   /locus_tag="AM1_B0035"
FT                   /gene_family="HOG000161263" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TetR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339905"
FT                   /db_xref="GeneID:5685673"
FT                   /translation="MARPKRNEHIREQLLDQGLKLFLTQGYHGTGIKEILDQINVPKGS
FT                   FYNYFESKEQFGAEVIRHFTKGVIANMSACLHDPEDDAITALQHFFEQEMHRHEDLKAG
FT                   CMLGNLGAELGGSSQLCQQAMIEGFQGMKQQFSFTLQRGQSQGKIRDDIDIEELADFLV
FT                   NAYEGALLRMQVEQSVQPIQQLSLLLNSYLAKT"
FT                   /protein_id="YP_001521075.1"
FT   misc_feature    23691..24233
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   AcrR; COG1309"
FT                   /db_xref="CDD:31500"
FT                   /locus_tag="AM1_B0035"
FT   misc_feature    23730..23870
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="AM1_B0035"
FT   gene            24390..24797
FT                   /db_xref="GeneID:5685674"
FT                   /locus_tag="AM1_B0036"
FT   CDS_pept        24390..24797
FT                   /locus_tag="AM1_B0036"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339906"
FT                   /db_xref="GeneID:5685674"
FT                   /translation="MKSTLRWNIPNQEFEDGSKISDWKQIESSPWHLQIESGYEMTFGI
FT                   YEHDGQFWKLYQARWVVEGTTEYLYRYGGQACRMTQVEYKSQARSPHSGLLKNVGDLEW
FT                   IRTYEVDAQLHRVIQVGRRDLKYDDHLDLVP"
FT                   /protein_id="YP_001521076.1"
FT   gene            24893..25516
FT                   /db_xref="GeneID:5685675"
FT                   /locus_tag="AM1_B0037"
FT   CDS_pept        24893..25516
FT                   /locus_tag="AM1_B0037"
FT                   /gene_family="HOG000023160" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339907"
FT                   /db_xref="GeneID:5685675"
FT                   /translation="MNLLTLQNVQNFDAYVFSKQPDYHEPTVRQEFAKAVPLRTVVVYC
FT                   YDPRAVGVPAAVAREFDEVYPGEILTDEQGNKIASTTTLFEVIVAGGRAIDALRSITVA
FT                   QHLFGIKNIVIVHHTHCGATSFTADGIVNAFQKEQGNDISTLYEQDSICISDFVTSLQH
FT                   DTRLVRASKGTPHNVDIYGYVYNIDTDELSLVTQDKGAPVQIGA"
FT                   /protein_id="YP_001521077.1"
FT   misc_feature    <25160..25477
FT                   /note="Carbonic anhydrases (CA) are zinc-containing enzymes
FT                   that catalyze the reversible hydration of carbon dioxide in
FT                   a two-step mechanism in which the nucleophilic attack of a
FT                   zinc-bound hydroxide ion on carbon dioxide is followed by
FT                   the regeneration of an...; Region: beta_CA; cl00391"
FT                   /db_xref="CDD:174168"
FT                   /locus_tag="AM1_B0037"
FT   misc_feature    order(25244..25246,25253..25255)
FT                   /note="zinc binding site; other site"
FT                   /db_xref="CDD:73199"
FT                   /locus_tag="AM1_B0037"
FT   gene            25491..25607
FT                   /db_xref="GeneID:5685676"
FT                   /locus_tag="AM1_B0038"
FT   CDS_pept        25491..25607
FT                   /locus_tag="AM1_B0038"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339908"
FT                   /db_xref="GeneID:5685676"
FT                   /translation="MHLSRLEPKTMTKADREVAVITAIGLGFAIIAQILLII"
FT                   /protein_id="YP_001521078.1"
FT   gene            25638..26090
FT                   /db_xref="GeneID:5685677"
FT                   /locus_tag="AM1_B0039"
FT   CDS_pept        25638..26090
FT                   /locus_tag="AM1_B0039"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339909"
FT                   /db_xref="GeneID:5685677"
FT                   /translation="MRTEKRLEISLAIIRISTAIFLLVWSTGKLLAPALTQNIFSKFYF
FT                   SEISLVMSYAVGVLQTILVLLFLVGLYKTFSYGVVLGMHSVSVLSTYEKLFNPYYPPNI
FT                   LFWAGVPVLAGLVALFLLRDHDHWLTLQWRAFTSSNSIKSHPHSLH"
FT                   /protein_id="YP_001521079.1"
FT   gene            26188..26925
FT                   /db_xref="GeneID:5685678"
FT                   /locus_tag="AM1_B0040"
FT   CDS_pept        26188..26925
FT                   /locus_tag="AM1_B0040"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339910"
FT                   /db_xref="GeneID:5685678"
FT                   /translation="MAKPICLVTGVGDGTGTAIVRRFVEGGYRVAMIARNRDRLRQLEQ
FT                   DMTDVKAYVCNVGDLDALLVTLNSIRREVGSPSVLIHNAVRATFGTFLEVHPEELERNF
FT                   RVNTTSLLYLARELVPNMMEKGKGTIIITGNTAAHRGIPSYALFAPTKAAQRILAQALA
FT                   RDLGPKGIHVAYITVDAVIDTPWSTNLPVQGLATEPLNQHSSQSKDFFCQPVDIAEEVF
FT                   HVAHQSSSAWSFDVEIRPFAEKW"
FT                   /protein_id="YP_001521080.1"
FT   misc_feature    26188..26922
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="AM1_B0040"
FT   misc_feature    26188..26883
FT                   /note="Dehydrogenases with different specificities (related
FT                   to short-chain alcohol dehydrogenases) [Secondary
FT                   metabolites biosynthesis, transport, and catabolism /
FT                   General function prediction only]; Region: FabG; COG1028"
FT                   /db_xref="CDD:31231"
FT                   /locus_tag="AM1_B0040"
FT   gene            27424..28518
FT                   /db_xref="GeneID:5685679"
FT                   /locus_tag="AM1_B0041"
FT   CDS_pept        27424..28518
FT                   /locus_tag="AM1_B0041"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acetyltransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339911"
FT                   /db_xref="GeneID:5685679"
FT                   /translation="MPQVSDAIVRPMRDDERQNVHALMRRAFPLLDQWAFSWTPYVLVA
FT                   EQGGQLQGAIVLKLFALPRNRQAGSIAWVFTAPEARGKGFGQRLVESGIDFFEKQGCDQ
FT                   ILTTVEGFNTSSSKLFATRGFKILPPEDQFRRYGLATLVVWAKLSHYFDLGHFLWARPV
FT                   APAVDSPSLQWWSTITANSLIGLLMLWRASGFRAFHPEMWLVLPGIFLVLFGLRHLGMW
FT                   LTAHRQGLTVRFRTWESGFLLSTAISLLFPGAVFPIPGSLYPITHQWRYRDLLPQLGWM
FT                   AVAGTLPVLILVWGVWVLGELNEPLPYVRAWLEAVLLVGKPLVLFDIAMPFFPFVSFNG
FT                   RQLWDWNKTVWGILAMATITIFLV"
FT                   /protein_id="YP_001521081.1"
FT   misc_feature    27427..27837
FT                   /note="Acetyltransferases, including N-acetylases of
FT                   ribosomal proteins [Translation, ribosomal structure and
FT                   biogenesis]; Region: RimL; COG1670"
FT                   /db_xref="CDD:31856"
FT                   /locus_tag="AM1_B0041"
FT   misc_feature    27547..27738
FT                   /note="N-Acyltransferase superfamily: Various enzymes that
FT                   characteristically catalyze the transfer of an acyl group
FT                   to a substrate; Region: NAT_SF; cd04301"
FT                   /db_xref="CDD:173926"
FT                   /locus_tag="AM1_B0041"
FT   misc_feature    order(27643..27651,27679..27684)
FT                   /note="Coenzyme A binding pocket; other site"
FT                   /db_xref="CDD:173926"
FT                   /locus_tag="AM1_B0041"
FT   gene            28601..28729
FT                   /db_xref="GeneID:5685680"
FT                   /locus_tag="AM1_B0042"
FT   CDS_pept        28601..28729
FT                   /locus_tag="AM1_B0042"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339912"
FT                   /db_xref="GeneID:5685680"
FT                   /translation="MKQESPAISEGLEGERQVSWKFTQGFIVCEDHGLFTDGDGFL"
FT                   /protein_id="YP_001521082.1"
FT   gene            complement(28769..29176)
FT                   /db_xref="GeneID:5685681"
FT                   /locus_tag="AM1_B0043"
FT   CDS_pept        complement(28769..29176)
FT                   /locus_tag="AM1_B0043"
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="endoribonuclease L-PSP"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339913"
FT                   /db_xref="GeneID:5685681"
FT                   /translation="MAPSLTYLNPASLPDASAFGYSQITIMEPGRLAFISGQVAWQSSG
FT                   EAVPDSLTGQAELVVKNAKAALDAVGASSEDIVMVRIYMVDLTPDRIEELMPHLLAMFD
FT                   GAKPSLTGVGVAALAGPELQLEIEMIARLPS"
FT                   /protein_id="YP_001521083.1"
FT   misc_feature    complement(28784..29116)
FT                   /note="YjgF, YER057c, and UK114 belong to a large family of
FT                   proteins present in bacteria, archaea, and eukaryotes with
FT                   no definitive function. The conserved domain is similar in
FT                   structure to chorismate mutase but there is no sequence
FT                   similarity and no...; Region: YjgF_YER057c_UK114_family;
FT                   cd00448"
FT                   /db_xref="CDD:100004"
FT                   /locus_tag="AM1_B0043"
FT   misc_feature    complement(order(28787..28789,28793..28795,28799..28801,
FT                   28832..28855,28880..28882,28889..28891,28928..28930,
FT                   28934..28936,28940..28945,28949..28951,29066..29071,
FT                   29075..29077,29081..29083,29096..29098,29102..29104,
FT                   29111..29116))
FT                   /note="homotrimer interaction site; other site"
FT                   /db_xref="CDD:100004"
FT                   /locus_tag="AM1_B0043"
FT   misc_feature    complement(order(28799..28801,28847..28849,28889..28891,
FT                   28901..28903,29114..29116))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:100004"
FT                   /locus_tag="AM1_B0043"
FT   gene            29499..29756
FT                   /db_xref="GeneID:5685682"
FT                   /locus_tag="AM1_B0044"
FT   CDS_pept        29499..29756
FT                   /locus_tag="AM1_B0044"
FT                   /gene_family="HOG000023161" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339914"
FT                   /db_xref="GeneID:5685682"
FT                   /translation="MMRLKLVPLFLMMALATVLGACEKANQDVPAPPVNQGDTPQGGAE
FT                   LNQSEDESAPSIQEEAPAPEAPLTPDGEETSPENSDEQSP"
FT                   /protein_id="YP_001521084.1"
FT   gene            complement(29776..29895)
FT                   /db_xref="GeneID:5685683"
FT                   /locus_tag="AM1_B0045"
FT   CDS_pept        complement(29776..29895)
FT                   /locus_tag="AM1_B0045"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339915"
FT                   /db_xref="GeneID:5685683"
FT                   /translation="MGVMTCVIFSSQSGLKIMDDFSQNALENQASSHTNAMSV"
FT                   /protein_id="YP_001521085.1"
FT   gene            30015..30149
FT                   /db_xref="GeneID:5685684"
FT                   /locus_tag="AM1_B0046"
FT   CDS_pept        30015..30149
FT                   /locus_tag="AM1_B0046"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339916"
FT                   /db_xref="GeneID:5685684"
FT                   /translation="MKRFKAQFPIQLVSTVIGLSSLLASLPVAARTPSSVINFDGVDT"
FT                   /protein_id="YP_001521086.1"
FT   gene            30204..30623
FT                   /db_xref="GeneID:5685685"
FT                   /locus_tag="AM1_B0047"
FT   CDS_pept        30204..30623
FT                   /locus_tag="AM1_B0047"
FT                   /gene_family="HOG000023162" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339917"
FT                   /db_xref="GeneID:5685685"
FT                   /translation="MKILCKNFSLNSRCSGTSQSDTTPSSEEAPDVEGAADTPESVESE
FT                   NLEPEDSTAPDMASSDTEPEEAPVDSSTTDDMDESTEGGAEQPDGTMGSPEEGTNSPDT
FT                   MPPDNTIPNEPTAPDDTQGPPVTPPMVPVPEGGTE"
FT                   /protein_id="YP_001521087.1"
FT   gene            30670..31224
FT                   /db_xref="GeneID:5685686"
FT                   /locus_tag="AM1_B0049"
FT   CDS_pept        30670..31224
FT                   /locus_tag="AM1_B0049"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339919"
FT                   /db_xref="GeneID:5685686"
FT                   /translation="MSNSPYPSNSDPSFHEPSLESSNATRYTELGRTVQAIRVENTRLN
FT                   SDVQQLRGRTSSLIGLLIGLILLTIGGFAWLAISLQNLEKEEQQRANGIDPALASQVEQ
FT                   LEKQVNDLRKFIPGNLSDTLQSNQTTLAQLQTQLQQVTTQIKTLERSASNSQPQSNTPP
FT                   QTAPPSNQQSSESPQLNNNQE"
FT                   /protein_id="YP_001521088.1"
FT   gene            complement(31175..31312)
FT                   /db_xref="GeneID:5685688"
FT                   /locus_tag="AM1_B0048"
FT   CDS_pept        complement(31175..31312)
FT                   /locus_tag="AM1_B0048"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339918"
FT                   /db_xref="GeneID:5685688"
FT                   /translation="MSLNRKDQAAIIGILEPISSVLNHLALKSSIPDYCSVVEIPRIVD
FT                   "
FT                   /protein_id="YP_001521089.1"
FT   gene            31467..32441
FT                   /db_xref="GeneID:5685687"
FT                   /locus_tag="AM1_B0050"
FT   CDS_pept        31467..32441
FT                   /locus_tag="AM1_B0050"
FT                   /codon_start="1"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339920"
FT                   /db_xref="GeneID:5685687"
FT                   /translation="MVAIHIDHLYKSFTFSRGWGKHRKQTNVVAVDRISLNIPCGQAIA
FT                   FIGPNGAGKSTTIKMLTGILHPTAGKAMVLGYVPWKDRQSLARRIGVVFGQRSQLWYHL
FT                   PPRDTLELLARIYDLEPKVFRQRRDSLVERFGLNEFWSTPVRKLSLGQRMRAEVAASLL
FT                   HAPQILFLDEPTIGLDVLARQKLRNLICEWNQQEGTTVFLTSHDTGDIERVAQRIIVIN
FT                   HGQVMLDAPVSELRRRYLNEKILSVKFHTPIYEFPTLQGVRQLEVMDFGLKLEINTRLI
FT                   PIEQVISQILQIGSVADVAIEDPPLDAVIAHIYNQPASEGLSL"
FT                   /protein_id="YP_001521090.1"
FT   misc_feature    31467..32414
FT                   /note="ABC-type uncharacterized transport system, ATPase
FT                   component [General function prediction only]; Region:
FT                   COG4586"
FT                   /db_xref="CDD:34224"
FT                   /locus_tag="AM1_B0050"
FT   misc_feature    31476..32153
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="AM1_B0050"
FT   misc_feature    31608..31631
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="AM1_B0050"
FT   misc_feature    order(31617..31622,31626..31634,31752..31754,31980..31985,
FT                   32082..32084)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="AM1_B0050"
FT   misc_feature    31743..31754
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="AM1_B0050"
FT   misc_feature    31908..31937
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="AM1_B0050"
FT   misc_feature    31968..31985
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="AM1_B0050"
FT   misc_feature    31992..32003
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="AM1_B0050"
FT   misc_feature    32070..32090
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="AM1_B0050"
FT   gene            complement(32617..33333)
FT                   /db_xref="GeneID:5685689"
FT                   /locus_tag="AM1_B0051"
FT   CDS_pept        complement(32617..33333)
FT                   /locus_tag="AM1_B0051"
FT                   /gene_family="HOG000023163" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339921"
FT                   /db_xref="GeneID:5685689"
FT                   /translation="MRGYSQCAKSLYHNVKSQVVRSITQVIEASKKHWVSEIECSRNIF
FT                   WEGKWQRVDGVAQQLKADHPESFRHKRVRCRNGKTREIWAFSKTVRLRKYGRKRLVIVH
FT                   ETEDLSDSPRFLLTDALHWDASRVFATWSYRWPCEIFHEFSKQLVGFESAQLRKEEAVK
FT                   RHFCLSCVAQSILQDTSCSGRKSERLKFAQNDEPTVGQKLYSLTRESVQQLVEFVHVLF
FT                   NQGQSVEQVMECIMPG"
FT                   /protein_id="YP_001521091.1"
FT   gene            33295..34404
FT                   /db_xref="GeneID:5685690"
FT                   /locus_tag="AM1_B0052"
FT   CDS_pept        33295..34404
FT                   /locus_tag="AM1_B0052"
FT                   /gene_family="HOG000023164" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339922"
FT                   /db_xref="GeneID:5685690"
FT                   /translation="MVERFGTLGVSPHLSSTPMIKIDFTAEEIQQLNYERYHHPHPRVQ
FT                   RRMEVLYLKSQGLSHTQICQLCQISRPTLAKTLRQYQQGGIEGLKTLEYKGQPSLLNAH
FT                   SDSVRAYFEQHPPRTSAEAQAVIEQLTGIKRSPTQIKAFLKRIGCRYRKVGYVPGKSSL
FT                   PEKIEEQEQFRHTRLEPLLEEAQRQERLVFFVDAAHFVHRAYLGFVWCITRIFIPSPSG
FT                   RQRFNVLGALDAITKDLVSVTNHTYINSHSMCLLLAKLALLDPVIPISVILDNARYQKC
FT                   QLVTDFAEIVDIELVYLPSYSPHLNLIERLWRFVRKECLYSKYYADFPAFKGAIQQCID
FT                   QCNGEHKAKLTTLLSLKFQSFKKVNILAA"
FT                   /protein_id="YP_001521092.1"
FT   misc_feature    33412..33810
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3415"
FT                   /db_xref="CDD:33221"
FT                   /locus_tag="AM1_B0052"
FT   misc_feature    33502..>33858
FT                   /note="Fanconi anemia group F protein (FANCF); Region:
FT                   FANCF; pfam11107"
FT                   /db_xref="CDD:151551"
FT                   /locus_tag="AM1_B0052"
FT   gene            34478..35788
FT                   /db_xref="GeneID:5685691"
FT                   /locus_tag="AM1_B0054"
FT   CDS_pept        34478..35788
FT                   /locus_tag="AM1_B0054"
FT                   /gene_family="HOG000023165" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339924"
FT                   /db_xref="GeneID:5685691"
FT                   /translation="MSASRSPEPTIGFVDEYCQLFAELFPQVRSYEAFKHLHLGMISDI
FT                   KRKSLPAIARAVGLENHQSLHHFLSESPWVASHLSDKRLDIILKILDGRRLILLIDETG
FT                   DCKKGKSTDYVKRQYIGNVGKKENGIVAVTAYGLFQGMILPLSFEVYKPRERLKEEDEY
FT                   LSKPQIAAGMIRQLQGMGFCFELVLADSLYGEAQTNFVNVLEELKLPYILAIRSNHAVW
FT                   LPAEQAVFAEPWQSFERTFSNGTTETRYRQEIIYGQRHHQKRYWLLTTDPQTLPENSTS
FT                   YVMAAAPEIKLDEIGDCYGFRTWIEYGLKQSKDTLGWADFRMTHYEQIEKWWEIVMSAF
FT                   LMVSLFADVFNDSCPVAHQHFAQHPWWDNQNGWKNLLNNVRLIIQPLISWNLLKRWLEV
FT                   FPSRALKKGFEQLTSKMEAFCCPLVRKLLKHPDFLSV"
FT                   /protein_id="YP_001521093.1"
FT   misc_feature    34505..35623
FT                   /note="FOG: Transposase [DNA replication, recombination,
FT                   and repair]; Region: COG5659"
FT                   /db_xref="CDD:35218"
FT                   /locus_tag="AM1_B0054"
FT   gene            complement(35760..36452)
FT                   /db_xref="GeneID:5685693"
FT                   /locus_tag="AM1_B0053"
FT   CDS_pept        complement(35760..36452)
FT                   /locus_tag="AM1_B0053"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339923"
FT                   /db_xref="GeneID:5685693"
FT                   /translation="MRSVFCRDDGFAHISRYLNGLLLSPNKTLQGIYSQLVWPEGEQVS
FT                   YRAMHEAIFEAGWHHQELMAHHRNVLGPKHRGRGREVISLDWTYSHHPYSQEIFGDKAA
FT                   YDHVNRCWSCYQTVVTAVAANPERLDGIAVEVQQPNYQLEELAYLRMTRRETYESMEQV
FT                   HQRLLELLHYQKNRLRYRKRTELAVDIVRQLEAERNFPDADYAFDQGVLTLELSLFYHF
FT                   RQRENQDA"
FT                   /protein_id="YP_001521094.1"
FT   gene            36412..36555
FT                   /db_xref="GeneID:5685692"
FT                   /locus_tag="AM1_B0055"
FT   CDS_pept        36412..36555
FT                   /locus_tag="AM1_B0055"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339925"
FT                   /db_xref="GeneID:5685692"
FT                   /translation="MWANPSSRQKTLRKDANDLAMVGAIPTRGSIGFEGIRQLPQFDQV
FT                   SA"
FT                   /protein_id="YP_001521095.1"
FT   gene            36567..37238
FT                   /db_xref="GeneID:5685694"
FT                   /locus_tag="AM1_B0056"
FT   CDS_pept        36567..37238
FT                   /locus_tag="AM1_B0056"
FT                   /gene_family="HOG000023166" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC transporter permease protein, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339926"
FT                   /db_xref="GeneID:5685694"
FT                   /translation="MRVTYSEVQAQQLGGFTLPQMLWYLSVTESLAISAPRIAQDVDQD
FT                   VRTGALTVQLVRPISYPMYRLWSSMGERCVRFGFNFAVSAVLALFFVGAIPMSIGGCLL
FT                   FLLVLPIAFILDFLVMFLIGLGAFWLEDTSGLVLIYSRLLWLLGGLMIPLELFPEFWQG
FT                   ILHNLPFALVIYAPARLFVHPSISDTLALLMRQGVALLMLTLCVQWVYGLAIQRIHANG
FT                   G"
FT                   /protein_id="YP_001521096.1"
FT   misc_feature    36603..37181
FT                   /note="Protein of unknown function (DUF990); Region:
FT                   DUF990; cl01496"
FT                   /db_xref="CDD:120686"
FT                   /locus_tag="AM1_B0056"
FT   gene            37243..37779
FT                   /db_xref="GeneID:5685695"
FT                   /locus_tag="AM1_B0057"
FT   CDS_pept        37243..37779
FT                   /locus_tag="AM1_B0057"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339927"
FT                   /db_xref="GeneID:5685695"
FT                   /translation="MKALLNYLNLAIAYVRLNWNAHMEYRGAFVSQLLAMLLNNLMWVA
FT                   FWGLFFTRFPVLRGWTVQDVVTLWAIAAAGFGLAHAIYGNALQLAKLIAQGQLDVWMLY
FT                   PRMLLPHLLLGQMNATSWGDLLFGYGVYLGFVHPDIVHFVWFIGLTTSVAALFVGFSVL
FT                   TGSLSFLHGQCLGAE"
FT                   /protein_id="YP_001521097.1"
FT   misc_feature    37303..>37749
FT                   /note="Protein of unknown function (DUF990); Region:
FT                   DUF990; cl01496"
FT                   /db_xref="CDD:120686"
FT                   /locus_tag="AM1_B0057"
FT   gene            37790..38038
FT                   /db_xref="GeneID:5685696"
FT                   /locus_tag="AM1_B0058"
FT   CDS_pept        37790..38038
FT                   /locus_tag="AM1_B0058"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339928"
FT                   /db_xref="GeneID:5685696"
FT                   /translation="MAMLTFSTYPGTLFDGAIKLLLYSFIPAGFVTYLPVEALRSLSWV
FT                   HAIGSVMGSVTILGIGIGVFYHGLRRYESGNLINMRG"
FT                   /protein_id="YP_001521098.1"
FT   misc_feature    <37799..38011
FT                   /note="Protein of unknown function (DUF990); Region:
FT                   DUF990; cl01496"
FT                   /db_xref="CDD:120686"
FT                   /locus_tag="AM1_B0058"
FT   gene            38078..38911
FT                   /db_xref="GeneID:5685697"
FT                   /locus_tag="AM1_B0059"
FT   CDS_pept        38078..38911
FT                   /locus_tag="AM1_B0059"
FT                   /gene_family="HOG000028072" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="alpha/beta hydrolase"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339929"
FT                   /db_xref="GeneID:5685697"
FT                   /translation="MDMTETFQLKIGSAQLAGEYSGHGKPLIFLHAGVADRRMWCPQID
FT                   TLKNYFQTVIYDRRGFGKTTCLDEAFSHVNDLRQVIEQLGLTDVVLIGCSQGGRIALDF
FT                   ALAYPHQVTALVLIAPAVSGAPEPITFPQNIQARINALDEADEANDLELVNTIETDLWL
FT                   DGPTSPSGRVDDSLRKLLLDMNGIALRKPELTLEQEPTSAYEKLPNLSIPTLVVWGNLD
FT                   FPHVSERCHYLVNTIPTAIGEEMPNTAHLLNLEEPEYLNNLLQAFLSSSNELKNT"
FT                   /protein_id="YP_001521099.1"
FT   misc_feature    38090..38827
FT                   /note="Predicted hydrolases or acyltransferases (alpha/beta
FT                   hydrolase superfamily) [General function prediction only];
FT                   Region: MhpC; COG0596"
FT                   /db_xref="CDD:30941"
FT                   /locus_tag="AM1_B0059"
FT   misc_feature    38228..38827
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176940"
FT                   /locus_tag="AM1_B0059"
FT   gene            38960..39508
FT                   /db_xref="GeneID:5685698"
FT                   /locus_tag="AM1_B0060"
FT   CDS_pept        38960..39508
FT                   /locus_tag="AM1_B0060"
FT                   /gene_family="HOG000078535" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acetyltransferase, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339930"
FT                   /db_xref="GeneID:5685698"
FT                   /translation="MHTFLETERLALRQFTLEDVDCLVELNSDPDVVRFATIDKQVDPA
FT                   SIQTQILPKWLQHYEDYEGYGFWAAIEKSSQTFIGWFLFRPAVHAPYFDPALAEPTDIE
FT                   LGYRLRKDSWGHGYATEGSKALIQKGFSELGAKRILAVVFSVNVASIRVLEKSGLHLDM
FT                   QFIDKHTGQEVVLYALNHC"
FT                   /protein_id="YP_001521100.1"
FT   misc_feature    38966..39496
FT                   /note="Acetyltransferases, including N-acetylases of
FT                   ribosomal proteins [Translation, ribosomal structure and
FT                   biogenesis]; Region: RimL; COG1670"
FT                   /db_xref="CDD:31856"
FT                   /locus_tag="AM1_B0060"
FT   misc_feature    <39272..39460
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:176420"
FT                   /locus_tag="AM1_B0060"
FT   gene            39660..40262
FT                   /db_xref="GeneID:5685699"
FT                   /locus_tag="AM1_B0061"
FT   CDS_pept        39660..40262
FT                   /locus_tag="AM1_B0061"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glucan synthesis regulatory protein, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339931"
FT                   /db_xref="GeneID:5685699"
FT                   /translation="MIAESWERIIEWGNRNAPEMLKDLNPGASEEQIAAVEAELGQPIP
FT                   ADFRASLLIHNGESDGWPCKVFADYGAYLGTESILESWKQRKQVAAEVENYADEMPDPE
FT                   QQIRDGIIFVEGPVRPKLFLPEWIPIMDCNGDVFWALDMNPEEGGVSGQVIAVDWEGCS
FT                   WKVIADSFRSFIRDYAQELENGAYRVVDEQPTKEDNQ"
FT                   /protein_id="YP_001521101.1"
FT   misc_feature    39663..40235
FT                   /note="SMI1 / KNR4 family; Region: SMI1_KNR4; cl01747"
FT                   /db_xref="CDD:154567"
FT                   /locus_tag="AM1_B0061"
FT   gene            complement(40306..41457)
FT                   /db_xref="GeneID:5685700"
FT                   /locus_tag="AM1_B0062"
FT   CDS_pept        complement(40306..41457)
FT                   /locus_tag="AM1_B0062"
FT                   /gene_family="HOG000253669" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339932"
FT                   /db_xref="GeneID:5685700"
FT                   /translation="MLDIQQAPSKPPQTTGWLALAEALGPQLAESEQAADISDQYVLEN
FT                   IKRLKEAGFTAAGVPTQLGGGGASHAEMCNVLRILGQHCSSTALALSMHTHQVMIPTWK
FT                   WQHQQMAVEGLLTRVAQEKIMLLSTGGADWLNGSGTATPSEGGFIINSRKGFVSGSPTG
FT                   DLLITSAIYDDPTAGKTVLHFALPMKSPGVSIDSVWQAMGMRGTGSHTVLLEDVFVSEQ
FT                   AISLRRPAGKWHPAFHLITLIAIPIIYSVYVGIAEAARDLTIQNAQKRRDDDHVCYLVG
FT                   GLENELTNAKLVQQQMIAIAASQSPSIETTNQIMTGRTLITQSVLKVVDAAMEITGGLA
FT                   FHRPYGLEKLFRDAQGARYHPMREEVQRKLAGQLALGNTPEIL"
FT                   /protein_id="YP_001521102.1"
FT   misc_feature    complement(40327..41403)
FT                   /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
FT                   CaiA; COG1960"
FT                   /db_xref="CDD:32143"
FT                   /locus_tag="AM1_B0062"
FT   misc_feature    complement(40327..41397)
FT                   /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
FT                   /db_xref="CDD:175048"
FT                   /locus_tag="AM1_B0062"
FT   misc_feature    complement(order(40351..40353,40357..40359,40363..40374,
FT                   40984..40986,40990..40992,41176..41178))
FT                   /note="active site"
FT                   /db_xref="CDD:173838"
FT                   /locus_tag="AM1_B0062"
FT   gene            41577..42299
FT                   /db_xref="GeneID:5685701"
FT                   /locus_tag="AM1_B0063"
FT   CDS_pept        41577..42299
FT                   /locus_tag="AM1_B0063"
FT                   /gene_family="HOG000044029" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339933"
FT                   /db_xref="GeneID:5685701"
FT                   /translation="MGKSYGQYCPVARAAEAICERWTPLVLRELMSGSCHFNEISRGVP
FT                   LMSRALLIKRLKELETAGIITRQDKKSGQGSIYQLTPAGEALRPIIKGMGEWAQQWGSD
FT                   RLTPEQLDPDLFMWGLRRGFNLEAMPDHKIVLQFDLRGIPRQRKTKRSYWVVTEKHRVD
FT                   VCIQDPGFDVDVLIAADLSAIIHVVMGYDPLDLALRAKTIQFEGNQDWVGQLPTWLFLN
FT                   GERRYLSGLATATIGTML"
FT                   /protein_id="YP_001521103.1"
FT   misc_feature    41601..41879
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="AM1_B0063"
FT   gene            42496..43740
FT                   /db_xref="GeneID:5685702"
FT                   /locus_tag="AM1_B0064"
FT   CDS_pept        42496..43740
FT                   /locus_tag="AM1_B0064"
FT                   /gene_family="HOG000023053" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339934"
FT                   /db_xref="GeneID:5685702"
FT                   /translation="MDNSIRIPLNLPDIRILELSKTERGDWLIKIESTLQGTTCHQCGR
FT                   EITDLHCHDQPFRIRHLPLFEVPVYLEIRPKRYRCKYCDDHPTTTQHLEWHEPRSPNTK
FT                   AYERWLLRILINSTVSDVARKLGVSEDIVSGIIDRWIAAQVDWSEYADLKVMGMDEISL
FT                   KRGHRDFVVLITIPTTDGVDILAVLADRKQQTVANFLQSIPIDLRQTIERVCTDMYQGF
FT                   VSAVREQLPQAKIVIDRFHVTKAYRNCADTVRKREVKRLRRELSKQEYDSIKGAMWPFR
FT                   KRPENLKESEQQLLERLFAYSPQLKQAYNLREKLTQIFEGRYTKHGAKCAIRAWCKQVL
FT                   KSDIKEFDCFLTTINNWMDEMTNYFLEGWTSGFVEGFNNRVKVLKRRCYGIFDIERLFQ
FT                   RISLDLNGYQTFAVT"
FT                   /protein_id="YP_001521104.1"
FT   misc_feature    42496..43704
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3464"
FT                   /db_xref="CDD:33267"
FT                   /locus_tag="AM1_B0064"
FT   misc_feature    42958..43227
FT                   /note="Transposase; Region: Transposase_12; pfam01610"
FT                   /db_xref="CDD:110601"
FT                   /locus_tag="AM1_B0064"
FT   gene            complement(43765..44835)
FT                   /db_xref="GeneID:5685703"
FT                   /locus_tag="AM1_B0065"
FT   CDS_pept        complement(43765..44835)
FT                   /locus_tag="AM1_B0065"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acetyltransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339935"
FT                   /db_xref="GeneID:5685703"
FT                   /translation="MTNSLTLREAKPEEAIQLSGLAMRSKSYWGYSDDFMEACRDELTV
FT                   TSEMIQDSKFHYVVAEMANEVVGFYGVERLSSLQFELEALFVDPVHIGSGIGRALITHA
FT                   RDFIGESGGRSLIIQGDPNAEEFYLAVGAQLIGEKESDSIPGRFLPIFRMEIAESKDTR
FT                   TVSLESETLEFRQRPKSAKTFVGEPINTEHLQIRPFTRGDIEPFTRFMTDQESTRFLTF
FT                   GDEQKSSQGARDLLEATITSYGTEHPMLAFAVEAPKTSTFIGFCGLTPHDEETIEIMYA
FT                   IMPDARRKGYATEVAAVLSQYALNKLGYLRVIAPIAPANEVSKIVATKVGFKDNGLVTD
FT                   VNSGELVHQFIWLSGN"
FT                   /protein_id="YP_001521105.1"
FT   misc_feature    complement(44482..44667)
FT                   /note="N-Acyltransferase superfamily: Various enzymes that
FT                   characteristically catalyze the transfer of an acyl group
FT                   to a substrate; Region: NAT_SF; cd04301"
FT                   /db_xref="CDD:173926"
FT                   /locus_tag="AM1_B0065"
FT   misc_feature    complement(order(44542..44547,44575..44583))
FT                   /note="Coenzyme A binding pocket; other site"
FT                   /db_xref="CDD:173926"
FT                   /locus_tag="AM1_B0065"
FT   misc_feature    complement(43816..44283)
FT                   /note="Acetyltransferases, including N-acetylases of
FT                   ribosomal proteins [Translation, ribosomal structure and
FT                   biogenesis]; Region: RimL; COG1670"
FT                   /db_xref="CDD:31856"
FT                   /locus_tag="AM1_B0065"
FT   misc_feature    complement(43837..44070)
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:176420"
FT                   /locus_tag="AM1_B0065"
FT   gene            complement(45023..45136)
FT                   /db_xref="GeneID:5685704"
FT                   /locus_tag="AM1_B0066"
FT   CDS_pept        complement(45023..45136)
FT                   /locus_tag="AM1_B0066"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339936"
FT                   /db_xref="GeneID:5685704"
FT                   /translation="MNNTRDEGKSIIHLPPWLVVHQLIGRLHSPILWRNYE"
FT                   /protein_id="YP_001521106.1"
FT   gene            complement(45182..46360)
FT                   /db_xref="GeneID:5685705"
FT                   /locus_tag="AM1_B0067"
FT   CDS_pept        complement(45182..46360)
FT                   /locus_tag="AM1_B0067"
FT                   /gene_family="HOG000023167" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339937"
FT                   /db_xref="GeneID:5685705"
FT                   /translation="MQISKRASFLLRLLAITLLAVVLDSRLTTKNMSQPHPEQRSFYQG
FT                   FIYQPYDWSDEAFEETFRVIGENSDIIGFYFDGFVPWNEAAAKKPYHPVQEQEIQKRIN
FT                   GIKPHQKIFLGTSLLGSDRVSLSGYLGEYEVPRTGKWKDKTFDDPEVIAAYLHWCRDLI
FT                   TRFQPDYFMYVAEVDSGLVNVDDPRFQSLLRSVKQIYPVLKREFPSLPILIEFVLENDE
FT                   QMSKRAEVTQSLLPYTDMYAVSTFPFIMTGGNPADIPKDWFSRAKEIAPDIPFAVVETN
FT                   FLAEDFYHPTQGIPIPFRKKRLLIPAREKWQAAYIEFLLSEAHRLEAEFVLYWGYRDLD
FT                   QLQAKLDGTGGAFDSNIHGFASLSKDCGLIDEKGRHRPSFNVWQRWLSLPRS"
FT                   /protein_id="YP_001521107.1"
FT   gene            46598..47008
FT                   /db_xref="GeneID:5685706"
FT                   /locus_tag="AM1_B0068"
FT   CDS_pept        46598..47008
FT                   /product="glyoxalase/bleomycin resistance
FT                   /gene_family="HOG000232027" [ FAMILY / ALN / TREE ]
FT                   protein/dioxygenase"
FT                   /codon_start="1"
FT                   /locus_tag="AM1_B0068"
FT                   /EC_number="1.13.11.27"
FT                   /EC_number="1.13.11.39"
FT                   /db_xref="GI:158339938"
FT                   /db_xref="GeneID:5685706"
FT                   /translation="MQLNPYLFFNGQCQSAFQFYEQCLGGKVETIMPYEGSPMEDQVPP
FT                   EWRNKVMHAELTVNNRVLMGSDGMPGEYEVPKGFSVSLNMDDPAKAEQIFQALAENGTV
FT                   SMPIQETFWAIRFGMVTDQFSIPWLINCDKPA"
FT                   /transl_table="11"
FT                   /protein_id="YP_001521108.1"
FT   misc_feature    46604..46990
FT                   /note="Escherichia coli PhnB and similar proteins; the E.
FT                   coli phnB gene is found next to an operon involved in the
FT                   cleavage of carbon-phosphorus bonds in unactivated
FT                   alkylphosphonates; Region: PhnB_like; cd06588"
FT                   /db_xref="CDD:176658"
FT                   /locus_tag="AM1_B0068"
FT   misc_feature    order(46604..46621,46667..46669,46775..46780,46787..46789,
FT                   46832..46849,46853..46855,46865..46867,46952..46954,
FT                   46982..46984)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:176658"
FT                   /locus_tag="AM1_B0068"
FT   gene            47053..47565
FT                   /db_xref="GeneID:5685707"
FT                   /locus_tag="AM1_B0069"
FT   CDS_pept        47053..47565
FT                   /locus_tag="AM1_B0069"
FT                   /gene_family="HOG000295688" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339939"
FT                   /db_xref="GeneID:5685707"
FT                   /translation="METTTPQQELTINHEPQKEHQWLQQLVGEWTYESDAKMGPDHPSE
FT                   KSTGTETVSTIGNFWVQCEGQGEMCGGPGTTIMTLGFDVQNQKFVGTWIGSMMAYLWQY
FT                   DGELNDTGKVLTLSSRGPSMAGDGTIGQYKDVIELKSDDHRIMTSHALGDNGQWYQFMT
FT                   TLYHRSK"
FT                   /protein_id="YP_001521109.1"
FT   misc_feature    47095..47562
FT                   /note="Protein of unknown function (DUF1579); Region:
FT                   DUF1579; pfam07617"
FT                   /db_xref="CDD:148951"
FT                   /locus_tag="AM1_B0069"
FT   gene            47523..47936
FT                   /db_xref="GeneID:5685708"
FT                   /locus_tag="AM1_B0070"
FT   CDS_pept        47523..47936
FT                   /locus_tag="AM1_B0070"
FT                   /gene_family="HOG000275714" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339940"
FT                   /db_xref="GeneID:5685708"
FT                   /translation="MVSVHDHTLSPEQMRNRTMNKHEKINYVEFPAKDMEATKEFFSTV
FT                   FGWSFIDYGPEYTAFSNEGIDGGFFKSNLTATTDKGSALIIFYSESLTKTQSKIEHSRG
FT                   SITKPIFSFPGGRRFHFSDPNGNEFAVWSDVDT"
FT                   /protein_id="YP_001521110.1"
FT   misc_feature    47595..47921
FT                   /note="N-terminal domain of Streptomyces griseus SgaA
FT                   (suppression of growth disturbance caused by A-factor at a
FT                   high concentration under high osmolality during early
FT                   growth phase), and similar domains; Region: SgaA_N_like;
FT                   cd07247"
FT                   /db_xref="CDD:176671"
FT                   /locus_tag="AM1_B0070"
FT   gene            48023..48175
FT                   /db_xref="GeneID:5685709"
FT                   /locus_tag="AM1_B0071"
FT   CDS_pept        48023..48175
FT                   /locus_tag="AM1_B0071"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339941"
FT                   /db_xref="GeneID:5685709"
FT                   /translation="MTFSRFLITQLSQPSPGDRQDELAFPKAGLFPKLAMKNKSRRVAN
FT                   GQYAV"
FT                   /protein_id="YP_001521111.1"
FT   gene            48400..49860
FT                   /db_xref="GeneID:5685710"
FT                   /locus_tag="AM1_B0072"
FT   CDS_pept        48400..49860
FT                   /locus_tag="AM1_B0072"
FT                   /gene_family="HOG000023168" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339942"
FT                   /db_xref="GeneID:5685710"
FT                   /translation="MNIKRWWWISSGTSILFIALIGLMWFRIDSSYQPNLEQLANEADI
FT                   IPHLKRRGISLNKSEAIPTGVFLQSLKFNNATEVNVTGYIWQIYDKSIFAKVPKDQDVP
FT                   VGFILPEAVDSGNNLDPQQAYRRSISDTEEVIGWYFESTLKQRFNYKKYPLDHKTVWIR
FT                   IWGKDFARSNMLVPDLNAYKSTQAGDTFGLDDSIVLGEWEVEETFFDFKTPQYDMDFGL
FT                   ETPLPQTPELYFNVVLKREFLGAFIVNLVPLLISAILLFATLLTITVKEGQADIFGFST
FT                   SEVLGVCSALFFVVLLSHIQIRQEIPGSDIIYIEYFYLAMYVALLGVAVDSYLFTHDSY
FT                   SSQFKFISYEDNIFPKLIFWPTLLGTSAFYSFLILKPFQPYKSNFLQPQTTHILLPSDR
FT                   PLVQREIFNTPPLEFAHTVRKSLPVTTLVNPPNGQSYHQFSSTSRTEQSHLTFLAQSSS
FT                   LQVTDLGASRHRIPGGARPSGWRSRSYS"
FT                   /protein_id="YP_001521112.1"
FT   gene            complement(50302..50766)
FT                   /db_xref="GeneID:5685711"
FT                   /locus_tag="AM1_B0073"
FT   CDS_pept        complement(50302..50766)
FT                   /locus_tag="AM1_B0073"
FT                   /gene_family="HOG000023169" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339943"
FT                   /db_xref="GeneID:5685711"
FT                   /translation="MLYSASYFEPQNHHGLLVSISRSHPRSFQVDTKLPFLAPSQTLLD
FT                   DWKHQQLTEAGYIDRYRQELQQAWPQVNSWLASLTPEGDCTLLCWEKAGEFCHRNLAMK
FT                   VVRKHRPDCYGGRDISADLGLKCPNCQALIIPGIDQSYCPDCREWITTPI"
FT                   /protein_id="YP_001521113.1"
FT   misc_feature    complement(50470..>50667)
FT                   /note="Protein of unknown function, DUF488; Region: DUF488;
FT                   cl01246"
FT                   /db_xref="CDD:154288"
FT                   /locus_tag="AM1_B0073"
FT   gene            complement(50766..51143)
FT                   /db_xref="GeneID:5685712"
FT                   /locus_tag="AM1_B0074"
FT   CDS_pept        complement(50766..51143)
FT                   /locus_tag="AM1_B0074"
FT                   /gene_family="HOG000023171" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339944"
FT                   /db_xref="GeneID:5685712"
FT                   /translation="MQTETKIPTRIKLRDWNVQKKAGAYVLKTPLMTHCWGCKQYRLAI
FT                   SAMPTGNHHQTQFKWFCQKRARNLGIQPSQELLKKLPTMNTLQSRYRKTQISQLQNVGW
FT                   TGDDLEECLQAAIENRSKAVF"
FT                   /protein_id="YP_001521114.1"
FT   gene            complement(51377..51910)
FT                   /db_xref="GeneID:5685713"
FT                   /locus_tag="AM1_B0075"
FT   CDS_pept        complement(51377..51910)
FT                   /locus_tag="AM1_B0075"
FT                   /gene_family="HOG000023062" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339945"
FT                   /db_xref="GeneID:5685713"
FT                   /translation="MTVSVPPPTLTSESQRLSQPSFNRPLGLGQSPSGLAIFCNRANTK
FT                   TWYTLDVNTQPQELEYPALTGYLVRIEFPPKEYRGEKSHKLRFKIQADRLYTLEAGYRS
FT                   VFAKGFLSEIAMLTPEQLRQPIIVEATPSDQEEKVLFCSVWLGSEKVYYRWDDQTNWKS
FT                   IAQRAMANVAGING"
FT                   /protein_id="YP_001521115.1"
FT   gene            52167..52343
FT                   /db_xref="GeneID:5685714"
FT                   /locus_tag="AM1_B0076"
FT   CDS_pept        52167..52343
FT                   /locus_tag="AM1_B0076"
FT                   /gene_family="HOG000023172" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339946"
FT                   /db_xref="GeneID:5685714"
FT                   /translation="MQINHLERAAIPGQDLSNVDFHGIASGHHEKGPLVGDTRGLNNKD
FT                   KKSKRRFWGRGYF"
FT                   /protein_id="YP_001521116.1"
FT   gene            complement(52613..52852)
FT                   /db_xref="GeneID:5685715"
FT                   /locus_tag="AM1_B0077"
FT   CDS_pept        complement(52613..52852)
FT                   /locus_tag="AM1_B0077"
FT                   /gene_family="HOG000023173" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339947"
FT                   /db_xref="GeneID:5685715"
FT                   /translation="MSFSEAGPMPPEITYAFVWVEDQIRVDAAVECGRRFKGIAWILDP
FT                   NSQNPSLRLDNPLGIRAVQAILDRTKIGFAAPTA"
FT                   /protein_id="YP_001521117.1"
FT   gene            complement(52905..53087)
FT                   /db_xref="GeneID:5685716"
FT                   /locus_tag="AM1_B0078"
FT   CDS_pept        complement(52905..53087)
FT                   /locus_tag="AM1_B0078"
FT                   /gene_family="HOG000023174" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339948"
FT                   /db_xref="GeneID:5685716"
FT                   /translation="MLNDPLTHAWQPWTDAEMSERNKAVSGNWILAFFQDGYSHDTIDS
FT                   GDSKDCVPDTHPEDN"
FT                   /protein_id="YP_001521118.1"
FT   gene            53364..53780
FT                   /db_xref="GeneID:5685717"
FT                   /locus_tag="AM1_B0079"
FT   CDS_pept        53364..53780
FT                   /locus_tag="AM1_B0079"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339949"
FT                   /db_xref="GeneID:5685717"
FT                   /translation="MNKDMPLDNLGQMSVNDLSECVEAGLNAGAYAIAQAGLALREIQR
FT                   RGEYPTTFEAFVKDKFALTRARAYQLMYAADIIADLASVFESNKLPRSESAVRPMIGLT
FT                   KQQRIEVWRRALKGKQRSPGYGTVKAIVEQMQAS"
FT                   /protein_id="YP_001521119.1"
FT   gene            53853..54932
FT                   /db_xref="GeneID:5685718"
FT                   /locus_tag="AM1_B0080"
FT   CDS_pept        53853..54932
FT                   /locus_tag="AM1_B0080"
FT                   /gene_family="HOG000097665" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339950"
FT                   /db_xref="GeneID:5685718"
FT                   /translation="MVFTMPNQTSLFSESNYADFLDGLKQRIRTAQVQAHLAVNQELVL
FT                   LYWQIGREILQRQKLEGWGSKVVERLAKDLKREFPDMRGFSRSNLMYMRAEAWPEEQIV
FT                   QEVLGQFPWYHNIALLEKLKSREQRLWYTHEIVNNGWSRNVLVHQIESNLYERKGSAIS
FT                   NFERTLPHPQSDLAQQIIKSPYNFDFLTISNDAHERELERSLIVHIRDFHMELGLGFSF
FT                   MGSQYPLVVSNKEYRLDLLFYHVHLHCYVIIDLKMGEFIPEYPGKMGFYIAAVDNMLRS
FT                   DRDDPTIGIILCKSKEKTIVEFALQGNQQPIGVSTYQIQSQLPENFQDKLPTIEQLEME
FT                   ISSVVEDIEDNDNSTRPNS"
FT                   /protein_id="YP_001521120.1"
FT   misc_feature    53910..54854
FT                   /note="Protein of unknown function (DUF1016); Region:
FT                   DUF1016; cl01979"
FT                   /db_xref="CDD:121012"
FT                   /locus_tag="AM1_B0080"
FT   gene            55380..55496
FT                   /db_xref="GeneID:5685719"
FT                   /locus_tag="AM1_B0081"
FT   CDS_pept        55380..55496
FT                   /locus_tag="AM1_B0081"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339951"
FT                   /db_xref="GeneID:5685719"
FT                   /translation="MSQLETDNLPIDETDILPEIDELDDVDLDDMLKDLQQD"
FT                   /protein_id="YP_001521121.1"
FT   gene            55532..56002
FT                   /db_xref="GeneID:5685720"
FT                   /locus_tag="AM1_B0082"
FT   CDS_pept        55532..56002
FT                   /locus_tag="AM1_B0082"
FT                   /gene_family="HOG000023069" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339952"
FT                   /db_xref="GeneID:5685720"
FT                   /translation="MDPNNLAVWKNVEARLGTPFRKNMVDLVLEMARDRTTDPHQIATW
FT                   MVTTSTYICSAIFGTNDPMPLLFLYVRALDTQYPDTMQEIYEIFSNEGLEKYAPSSLKR
FT                   GDLTSILWAAGSTFANGELKLIDDEIHINPKGLQRLRSIWQAPSRQTNNRQS"
FT                   /protein_id="YP_001521122.1"
FT   gene            56111..56539
FT                   /db_xref="GeneID:5685721"
FT                   /locus_tag="AM1_B0083"
FT   CDS_pept        56111..56539
FT                   /locus_tag="AM1_B0083"
FT                   /gene_family="HOG000023175" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339953"
FT                   /db_xref="GeneID:5685721"
FT                   /translation="MSQQSESPQWQPIRVMHECIPMVDGMLEEVQSQHSNMLEAQKKPH
FT                   TMDDATIQRVIDVYSEQHEFLWVYREQFSRWKQESPSPQQLKDIIRLEQQVEKIAQALT
FT                   GILNIVDDIKDKTIESILGKSDMELAMDVLMGNLKMPE"
FT                   /protein_id="YP_001521123.1"
FT   gene            56586..56828
FT                   /db_xref="GeneID:5685722"
FT                   /locus_tag="AM1_B0084"
FT   CDS_pept        56586..56828
FT                   /locus_tag="AM1_B0084"
FT                   /gene_family="HOG000023176" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339954"
FT                   /db_xref="GeneID:5685722"
FT                   /translation="MPSTQEPVRGIPLKEKPEGISRCGMSHATIAQNIFTSRWYEISAN
FT                   GQVIGSALDLDFYKQDATQGQNSGSTVKTKELSKV"
FT                   /protein_id="YP_001521124.1"
FT   gene            57003..57380
FT                   /db_xref="GeneID:5685723"
FT                   /locus_tag="AM1_B0085"
FT   CDS_pept        57003..57380
FT                   /locus_tag="AM1_B0085"
FT                   /gene_family="HOG000232613" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158339955"
FT                   /db_xref="GeneID:5685723"
FT                   /translation="MPRKKKQTKPLTGKDLVAKVKQLSDYTREEKAKACGYISADKDGS
FT                   ERIKTIAFLNALLDAEGIDLDSQSPNGNGNSGRKASYKVSVQSNGNILVGRTYTQALEL
FT                   EPGDEFEIAVGRKHIHLTKVA"
FT                   /protein_id="YP_001521125.1"
FT   gene            57583..57858
FT                   /db_xref="GeneID:5685724"
FT                   /locus_tag="AM1_B0086"