(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4

ID   ACAM1_4; SV 1; empty ; DNA; empty ; PRO; 273121 BP.
XX
AC   NC_009928;
XX
PR   Project: 58167;
XX
DE   Acaryochloris marina MBIC11017 plasmid pREB3, complete sequence.
XX
OS   Acaryochloris marina MBIC11017
OC   Bacteria; Cyanobacteria; Acaryochloris.
XX
RN   [1]
RP   1-273121
RX   PUBMED; 18252824.
RA   Swingley,W.D., Chen,M., Cheung,P.C., Conrad,A.L., Dejesa,L.C., Hao,J.,
RA   Honchak,B.M., Karbach,L.E., Kurdoglu,A., Lahiri,S., Mastrian,S.D.,
RA   Miyashita,H., Page,L., Ramakrishna,P., Satoh,S., Sattley,W.M., Shimada,Y.,
RA   Taylor,H.L., Tomo,T., Tsuchiya,T., Wang,Z.T., Raymond,J., Mimuro,M.,
RA   Blankenship,R.E. and Touchman,J.W.;
RT   "Niche adaptation and genome expansion in the chlorophyll d-producing
RT   cyanobacterium Acaryochloris marina";
RL   Proc. Natl. Acad. Sci. U.S.A. 105 (6), 2005-2010 (2008)
XX
RN   [2]
RP   1-273121
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (17-OCT-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-273121
RA   Touchman,J.;
RT   "Direct Submission";
RL   Submitted (25-SEP-2007) Translational Genomics Research Institute, 13208 E
RL   Shea Blvd, Scottsdale, AZ 85004, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000840.
CC   Source bacteria from Marine Biotechnology Institute Culture
CC   Collection, Marine Biotechnology Institute, 3-75-1 Heita, Kamaishi,
CC   Iwate 026-0001, Japan.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..273121
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:329726"
FT                   /note="type strain of Acaryochloris marina"
FT                   /strain="MBIC11017"
FT                   /plasmid="pREB3"
FT                   /organism="Acaryochloris marina MBIC11017"
FT   gene            join(272785..273121,1..323)
FT                   /db_xref="GeneID:5686041"
FT                   /locus_tag="AM1_C0001"
FT   CDS_pept        join(272785..273121,1..323)
FT                   /locus_tag="AM1_C0001"
FT                   /gene_family="HOG000135602" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340456"
FT                   /db_xref="GeneID:5686041"
FT                   /translation="MGALGTELTSYSKNESQAKPVKEWGSVVTAYTIDFSPITKLTDEQ
FT                   FDLLCEANPEIKFERTPTGELVIMPPTGGETGRGNAKLTSRFVVWSERYGLGEVFDSST
FT                   CFRIPSGGDRSPDVAWVEKSRWDALTPEQQRKFPPICPDFVLELLSPSDNLTATQRKMQ
FT                   EYLTSGIRLGWLINPEDKQVEIYRPGQEVEVLQSPSSVSGEEVLLEFSLNLEWIWR"
FT                   /protein_id="YP_001521450.1"
FT   misc_feature    join(272974..273121,1..308)
FT                   /note="Domain of unknown function (DUF820). This family
FT                   consists of hypothetical proteins that are greatly expanded
FT                   in cyanobacteria. The proteins are found sporadically in
FT                   other bacteria. They have been predicted to belong to the
FT                   PD-(D/E)xK superfamily of...; Region: DUF820; cd06260"
FT                   /db_xref="CDD:99749"
FT                   /locus_tag="AM1_C0001"
FT   misc_feature    order(273010..273012,12..14,102..104,144..146,156..158)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:99749"
FT                   /locus_tag="AM1_C0001"
FT   gene            330..467
FT                   /db_xref="GeneID:5686224"
FT                   /locus_tag="AM1_C0002"
FT   CDS_pept        330..467
FT                   /locus_tag="AM1_C0002"
FT                   /gene_family="HOG000022973" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340457"
FT                   /db_xref="GeneID:5686224"
FT                   /translation="MKEAGFSENSRSREGHPKLAKDAAIAKPYLVAMTAGLQEMATETL
FT                   "
FT                   /protein_id="YP_001521451.1"
FT   gene            complement(475..1260)
FT                   /db_xref="GeneID:5686225"
FT                   /locus_tag="AM1_C0003"
FT   CDS_pept        complement(475..1260)
FT                   /locus_tag="AM1_C0003"
FT                   /gene_family="HOG000022974" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340458"
FT                   /db_xref="GeneID:5686225"
FT                   /translation="MKTLRWLIDLHPEFPASEIVAEYLRQHKKIEPIVIDRDDVMLGRW
FT                   PDTEDWIVGYGTMFAMTRLLRHPPLSTAIFDDYSSLRCSKYYSYIYPFLGRAFLFAPFG
FT                   ALPNLPLQRMFGDNIFVRSDTNYKLFPAEVLKTQELPHWVKTYSHHQNELAVVSEVVSF
FT                   ETEYRCFCRNGIFFCGSSYPDEPYSEVPQEIRSVAESVAQALGVTGMNMLTIDIGIHAG
FT                   EPKLVEIGGVNSWGIYGSNVADFIAAMEEEAIDRWEDFI"
FT                   /protein_id="YP_001521452.1"
FT   gene            complement(1457..1954)
FT                   /db_xref="GeneID:5686226"
FT                   /locus_tag="AM1_C0004"
FT   CDS_pept        complement(1457..1954)
FT                   /locus_tag="AM1_C0004"
FT                   /gene_family="HOG000291291" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="rod shape-determining-related protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340459"
FT                   /db_xref="GeneID:5686226"
FT                   /translation="MNLVQRLMGIFSEDLLIELTKSEVSITSFTSGATVKDKPLIAVSG
FT                   EKNKLTVEGVGAECQNMSKPGLQLINPFDHSRSFVANFTYAEKILQYLIRKLLRNRLIT
FT                   SPRVIIHQLEKNEGGLTEIEERVLRELALGAGAREVIVFQGSKINTNVDTYQTIKQRFD
FT                   AT"
FT                   /protein_id="YP_001521453.1"
FT   misc_feature    complement(<1541..1816)
FT                   /note="hypothetical protein; Provisional; Region: PRK10039"
FT                   /db_xref="CDD:170217"
FT                   /locus_tag="AM1_C0004"
FT   gene            complement(2064..2267)
FT                   /db_xref="GeneID:5686227"
FT                   /locus_tag="AM1_C0005"
FT   CDS_pept        complement(2064..2267)
FT                   /locus_tag="AM1_C0005"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340460"
FT                   /db_xref="GeneID:5686227"
FT                   /translation="MAMPEMCSGSRNPTDSGVTEEVANYEYVARTGVQVYIPELNDCDE
FT                   TLSLGSYLVTFPKALKLEEYCV"
FT                   /protein_id="YP_001521454.1"
FT   gene            complement(2686..3132)
FT                   /db_xref="GeneID:5686228"
FT                   /locus_tag="AM1_C0006"
FT   CDS_pept        complement(2686..3132)
FT                   /locus_tag="AM1_C0006"
FT                   /gene_family="HOG000022977" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340461"
FT                   /db_xref="GeneID:5686228"
FT                   /translation="MTQVLTAQVLFPAKEWDTQYGPRLNAKIKVANGEEAKLWGPPGDA
FT                   ALLALRRGQTIQIAKDGKGKYSLVEQAPVPGQSPVDEGAPLDDGELNGEVKNAIASYIT
FT                   HRAALYSFCYQEASRELEKHEASEETVKCAASTLFIAAQKKFGI"
FT                   /protein_id="YP_001521455.1"
FT   gene            complement(3293..3634)
FT                   /db_xref="GeneID:5686229"
FT                   /locus_tag="AM1_C0007"
FT   CDS_pept        complement(3293..3634)
FT                   /locus_tag="AM1_C0007"
FT                   /gene_family="HOG000022978" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340462"
FT                   /db_xref="GeneID:5686229"
FT                   /translation="MDVQLLEVLSIQLNVGDILEIAFTGEEFASEQMIEIPIACKLVKK
FT                   DTLLLYFHPHELDLDLNTLDIHSKKDQRYLTVHSLEIVDAEKGYLATYEEEEFVRYQVM
FT                   WKKIANISD"
FT                   /protein_id="YP_001521456.1"
FT   gene            complement(3677..3832)
FT                   /db_xref="GeneID:5686230"
FT                   /locus_tag="AM1_C0008"
FT   CDS_pept        complement(3677..3832)
FT                   /locus_tag="AM1_C0008"
FT                   /gene_family="HOG000022979" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340463"
FT                   /db_xref="GeneID:5686230"
FT                   /translation="MKFHVAKLLVWNGRSFLMVDIQMTQTQESLGSVIREYVASMGVQL
FT                   VYWCKV"
FT                   /protein_id="YP_001521457.1"
FT   gene            complement(4020..4808)
FT                   /db_xref="GeneID:5686231"
FT                   /locus_tag="AM1_C0009"
FT   CDS_pept        complement(4020..4808)
FT                   /locus_tag="AM1_C0009"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340464"
FT                   /db_xref="GeneID:5686231"
FT                   /translation="MQNQLEGSKWMANFQEIHAHMEFEEWAYQQGLQDSEKYLIETYLD
FT                   KSGKTVEAGTGGGRILLAMQNLGFKHLYGFDYLTDFIDAATKNDQTQQIIFTAQNASQL
FT                   NYQDCFFDNAIYLQQVVCYPDSDTERLKVLQEAYRILKVGGIAIFSVLLFDARLKSLAY
FT                   SLFIQYIRLLRVLRFSQRSIQYLPSLQIQRQNNYSALLDAPPYMYWYKMEEFYRALTEL
FT                   NFEVIAMGTNHQVDCRKTSDTPTELAQLSLGNQLYCVCRK"
FT                   /protein_id="YP_001521458.1"
FT   misc_feature    complement(4347..4658)
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cd02440"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="AM1_C0009"
FT   misc_feature    complement(order(4455..4457,4506..4514,4578..4583,
FT                   4632..4652))
FT                   /note="S-adenosylmethionine binding site; other site"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="AM1_C0009"
FT   gene            complement(4853..5197)
FT                   /db_xref="GeneID:5686232"
FT                   /locus_tag="AM1_C0010"
FT   CDS_pept        complement(4853..5197)
FT                   /locus_tag="AM1_C0010"
FT                   /gene_family="HOG000269309" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340465"
FT                   /db_xref="GeneID:5686232"
FT                   /translation="MATIEATYASTIAQLNDEFRQGNHSLGRIFTTPGVDALSSEDQQE
FT                   LFRLVRTFDEFTEDNDPRGERDFGFIKFKGEVFNFKIDYYAPDMIHGSEDPEDLTITTR
FT                   VLTLMHSSEY"
FT                   /protein_id="YP_001521459.1"
FT   misc_feature    complement(4859..5110)
FT                   /note="Protein of unknown function (DUF3768); Region:
FT                   DUF3768; pfam12599"
FT                   /db_xref="CDD:153033"
FT                   /locus_tag="AM1_C0010"
FT   gene            complement(5263..5556)
FT                   /db_xref="GeneID:5686233"
FT                   /locus_tag="AM1_C0011"
FT   CDS_pept        complement(5263..5556)
FT                   /locus_tag="AM1_C0011"
FT                   /gene_family="HOG000022980" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340466"
FT                   /db_xref="GeneID:5686233"
FT                   /translation="MNTTLTQMEQWIDERVTDPLHPEYFLLYAQVEFWPGVREGGALEE
FT                   YYIIIKNRVGSVGDRLRDWVLKRFGVSARLADWETIPSLRQLRAESQYEDEF"
FT                   /protein_id="YP_001521460.1"
FT   gene            5909..6154
FT                   /db_xref="GeneID:5686234"
FT                   /locus_tag="AM1_C0012"
FT   CDS_pept        5909..6154
FT                   /locus_tag="AM1_C0012"
FT                   /gene_family="HOG000225389" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="helix-turn-helix domain-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340467"
FT                   /db_xref="GeneID:5686234"
FT                   /translation="MLTLLELVENLELSFSQWFLLMRRKQGLTQDDIAEALGISGQSVS
FT                   NWERGRSIPTLTIDQVKTLCKILDCTLNDIPSSDTE"
FT                   /protein_id="YP_001521461.1"
FT   misc_feature    5972..6133
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cd00093"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="AM1_C0012"
FT   misc_feature    order(5975..5977,6050..6052)
FT                   /note="salt bridge; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="AM1_C0012"
FT   misc_feature    order(5978..5980,6053..6055)
FT                   /note="non-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="AM1_C0012"
FT   misc_feature    order(5996..6001,6032..6034,6041..6043,6053..6058)
FT                   /note="sequence-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="AM1_C0012"
FT   gene            6861..10283
FT                   /db_xref="GeneID:5686235"
FT                   /locus_tag="AM1_C0013"
FT   CDS_pept        6861..10283
FT                   /locus_tag="AM1_C0013"
FT                   /gene_family="HOG000023186" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340468"
FT                   /db_xref="GeneID:5686235"
FT                   /translation="MTLSGQIEGYRYLGQSKDGLWGKYVLDDGKDLSQEDRERRWQEQR
FT                   ILREQRAQAEAQRHAQSLPASERDQHYRQLLDQLTLHPADRADLHRRGFTNEQIQDWGV
FT                   KSVEQWQSLSSELPHTLPGVGLDGQSLITPRPGYLCSIVDAEDLIVGFQVRARTSEGGR
FT                   YYWLTGKTRKRPTGPTPHLPTGELPLAVHRPEQITRDAIALVEGTGAKPHLLAQRLGQV
FT                   TIGAAGGLFAASPATLKASLAQLGANTIEFYPDAGAIQNKSVLRQYRATWKLLKDWGYT
FT                   VTVAWWKQTDKRIHTDIDELDDFSQIQYLSVAEFERIAAQCNGLLHQLQQALSKLTRPS
FT                   SPVQGFATPNDQQTHPPNPRGTKRTAPDDKRLATLPATSRRAKRSRRRTARLLTAHRRH
FT                   GYISKLRLENYRRRIRRHTSRATHSRCSSLQSRPGDNGTLETTTPLVHEYEPGQRLQTW
FT                   QTLISSGFPYILDQSQPGTGKSYDSGNVTPIGFGVEQVIYLSDQHRNPTVSTLEQGNGW
FT                   CDLEARHGGLNRVKNRLQRSAKGDAFAVPANCSRIGVLNALRDKNIPGADTANLICGTC
FT                   VAREACINANGPGYGFLNQRRNVLGVPLLRAHPDSLPDPEDYPLENTMLIWDEPGQNFQ
FT                   VKQSVTVTFTDLQQTISGLITYPEIFALVQPLLSALLPLMDGSEKLGKFGLNHLAVKGR
FT                   LPDMTGVKLGEIALILMPNLGFLNTTSDYGIDLADLPKQLRKKFSERDSEMAEQARNGV
FT                   VKQWLVPLIRILQGGAGCIQVSRYGLLTLNTPNPRHRDLAQAAQANVFLDATLSREDLA
FT                   LKLGCSPDEILVVRQAVPDTGNLEVIQVTDMGRVGMSRGGDQTKRIDALVKHYQELDAA
FT                   STKTIDFKKFEKDGAWWRDSRGVNDFLNVQTLILVGTPCRNLNDLAAEFAMVCGHYPDE
FT                   EESAFKAFVDRSILAEIHQAIGRLRAHRRPGESLQVVLISNIEMDCPVDRVQAKELTLD
FT                   AAHKAERVRLAIESAILQLQAKGKKVTQQVVSAMTQIPRGTIARYWRLFISLLEGLNSR
FT                   MNNSKKVLEADQDCHQAIAGVLDELSELPVNDLLPSLNEVFFDWLKPREWANVWDKVNA
FT                   SSQMAILEGIAMVLPLKMLDQALSEIEMQFQIC"
FT                   /protein_id="YP_001521462.1"
FT   gene            complement(10624..12657)
FT                   /db_xref="GeneID:5686236"
FT                   /locus_tag="AM1_C0014"
FT   CDS_pept        complement(10624..12657)
FT                   /locus_tag="AM1_C0014"
FT                   /gene_family="HOG000023187" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="two-component hybrid sensor and regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340469"
FT                   /db_xref="GeneID:5686236"
FT                   /translation="MTEKFEADSLQLLQTWQQTILDSADFIVISTDINGVVQTLNAGAL
FT                   KQFGYSSEEIIGRVTPIIFHDSAEIVLRAQVLSKELGRVIEADVETLIVKARMGMADEN
FT                   IWTLIRKDHSQFMVCLSVKALRDASGQLKGFLGIGKDVTAQQETEAALRCLNANLEQLV
FT                   EERTSQLNTAIETAEIANQAKSKFIANMSHEFRTPLNAIMGFSQLLLRDRRITPDQQSR
FT                   LDVIYRSGEHLLSLVNEVITLSKIEDGVLTYEPKDVNLYHLCEGVKELFSLQASSKDIQ
FT                   LQLRIAPDVPRFIRTDAQKLRQILINLLGNALKYTKRGSVECRVQWRPPRTETLPHHIE
FT                   FSIQDTGPGIPQHLLPKLFEHFVQDPLTRDKFGGIGLGLCICQRFVHLMGGDISIESTE
FT                   DHGTIVDFYIQVDLGESFQEPIVTQATVVGIEEPQSSLRVLVVEDHQDTQEMLVNLLET
FT                   VGFIVRSARGGLQAISLWQEWCPHLILMDWQMPEMNGYQTTQRIRQLESENDSSCLRVS
FT                   GEYPLLADKAAADPIVVEGRTAIIALTASVFEDTKKESKESGCDGFLCKPFQESLLFKI
FT                   IAEHLEVKYTYQKPDFMNGHSDPVKVSNPRSSKELLEEVSQLSEDWLLSFEQAALELDE
FT                   EVLHNMLSDISSQHPLLTEELNRLLTNLRFDIILDLVQQAIN"
FT                   /protein_id="YP_001521463.1"
FT   misc_feature    complement(12202..12594)
FT                   /note="PAS domain S-box; Region: sensory_box; TIGR00229"
FT                   /db_xref="CDD:161776"
FT                   /locus_tag="AM1_C0014"
FT   misc_feature    complement(12232..12588)
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="AM1_C0014"
FT   misc_feature    complement(order(12319..12321,12334..12336,12460..12471,
FT                   12508..12510,12526..12528,12538..12540))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="AM1_C0014"
FT   misc_feature    complement(order(12292..12294,12298..12300,12430..12435,
FT                   12442..12444,12466..12468,12478..12480))
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="AM1_C0014"
FT   misc_feature    complement(11923..12117)
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="AM1_C0014"
FT   misc_feature    complement(order(11938..11940,11950..11952,11959..11961,
FT                   11971..11973,11980..11982,11992..11994,12043..12045,
FT                   12052..12054,12064..12066,12073..12075,12085..12087,
FT                   12097..12099))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="AM1_C0014"
FT   misc_feature    complement(12079..12081)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="AM1_C0014"
FT   misc_feature    complement(11431..11757)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="AM1_C0014"
FT   misc_feature    complement(order(11443..11445,11449..11454,11467..11469,
FT                   11473..11475,11521..11532,11608..11613,11617..11619,
FT                   11623..11625,11629..11631,11716..11718,11725..11727,
FT                   11737..11739))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="AM1_C0014"
FT   misc_feature    complement(11725..11727)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="AM1_C0014"
FT   misc_feature    complement(order(11524..11526,11530..11532,11611..11613,
FT                   11617..11619))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="AM1_C0014"
FT   misc_feature    complement(10915..11340)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="AM1_C0014"
FT   misc_feature    complement(order(10957..10962,10969..10971,11026..11028,
FT                   11173..11175,11197..11199,11326..11331))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="AM1_C0014"
FT   misc_feature    complement(11197..11199)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="AM1_C0014"
FT   misc_feature    complement(order(11173..11181,11185..11190))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="AM1_C0014"
FT   misc_feature    complement(10954..10962)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="AM1_C0014"
FT   gene            complement(13046..14269)
FT                   /db_xref="GeneID:5686237"
FT                   /locus_tag="AM1_C0015"
FT   CDS_pept        complement(13046..14269)
FT                   /locus_tag="AM1_C0015"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340470"
FT                   /db_xref="GeneID:5686237"
FT                   /translation="MGLAVIHWITLKPLGWPLNVQLPLLSRLPMKVSLFLGFNHHRLPM
FT                   KCKTITSWLGVMVVGLIIQACNQHSGGGTVSVDPTLFYEDALVGDIAEELCTLSGGTET
FT                   ICYRITVKSTPVDHQAVPWCPETISDGDKAGGIWPDGGKINNVDGAFIKNLEAFYSDDQ
FT                   WKLYRDDGSVRVTDSKEACVAARPNVDEDYQNFCVQCLLSYLEKGMVNTHIIPIKPVQQ
FT                   TKPRQIARTSGGLALNGVNFDPPAPTNAILSARTLTPFDDCGGHIHLNHGYHYHAHTGC
FT                   LTEVAQEDTHSLMIGHALEGFSLHARLEEQSAEESSLDECRGHSNETRGYHYHVTDPGS
FT                   NSFINCFQRSMGARLKEMGKGRPVMPHQQTIEGDRVAPLVRVRENPEDRMMKQSKNLIV
FT                   HNLIYNLA"
FT                   /protein_id="YP_001521464.1"
FT   gene            14446..15729
FT                   /db_xref="GeneID:5686238"
FT                   /locus_tag="AM1_C0016"
FT   CDS_pept        14446..15729
FT                   /locus_tag="AM1_C0016"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340471"
FT                   /db_xref="GeneID:5686238"
FT                   /translation="MAQGTNLLYQRYRSIALAVYICVLLAGLLDWLDGGLGPRSIITAP
FT                   DSLRFFVFASTVLALTGLELRTLVNGTYSPTRKKNVLLFLVRLVLFSGACLVTDLHYSK
FT                   ILFLPILLYGYFTVSQRLSYVIALLGVAILFILSAANIGGIRPPPPLGVSKLGGLIDRS
FT                   TGSLIALLFTLLLAQAMSEAIQAQQKLTHLLQSLESSHRQLQAYASRVADLAAIEERNR
FT                   LARDIHDSLGHHLAAINIQLEKASAYRERDSDRAYEAVKHAQETVQDALKDVRASVSSL
FT                   RQEGIPFAFQASLEELIRRMDHSDLDITLNQSGECVNYSSLKLMTLYRVLQEGLTNIHK
FT                   HAHASQAHINLNFGPQNITLELIDNGLGFDVAAWKSQKNQQTNHGIIGLQERLSLVGGT
FT                   LDITSHSQATTLAINIPQDLPQINYRAE"
FT                   /protein_id="YP_001521465.1"
FT   misc_feature    15100..15291
FT                   /note="Histidine kinase; Region: HisKA_3; pfam07730"
FT                   /db_xref="CDD:149021"
FT                   /locus_tag="AM1_C0016"
FT   misc_feature    15424..15693
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cl00075"
FT                   /db_xref="CDD:173995"
FT                   /locus_tag="AM1_C0016"
FT   gene            15735..16382
FT                   /db_xref="GeneID:5686239"
FT                   /locus_tag="AM1_C0017"
FT   CDS_pept        15735..16382
FT                   /locus_tag="AM1_C0017"
FT                   /gene_family="HOG000034813" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="two-component LuxR family transcriptional
FT                   regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340472"
FT                   /db_xref="GeneID:5686239"
FT                   /translation="MAIQILLVDDQYLIREGIASLLELEEDLEVAGMAANGKEAIKQAI
FT                   DLKPNIILMDIRMPELNGVEATAKIKQSLPHCQIIMLTTFDDEELIVQSLLAGACGYLM
FT                   KDIPPDDLGQAIKLADAGVFQLAPEVAGKLIGSLKTQRAGDAPKLPTDTPLTTRELEVL
FT                   KLLAKGNTNKEIAKAFNLSEGTVKNHVSNILMRLGLRDRTQAAVYAVEHGLS"
FT                   /protein_id="YP_001521466.1"
FT   misc_feature    15741..16376
FT                   /note="Response regulator containing a CheY-like receiver
FT                   domain and an HTH DNA-binding domain [Signal transduction
FT                   mechanisms / Transcription]; Region: CitB; COG2197"
FT                   /db_xref="CDD:32379"
FT                   /locus_tag="AM1_C0017"
FT   misc_feature    15750..16091
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="AM1_C0017"
FT   misc_feature    order(15759..15764,15897..15899,15921..15923,15981..15983,
FT                   16038..16040,16047..16052)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="AM1_C0017"
FT   misc_feature    15897..15899
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="AM1_C0017"
FT   misc_feature    order(15906..15911,15915..15923)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="AM1_C0017"
FT   misc_feature    16047..16055
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="AM1_C0017"
FT   misc_feature    16197..16367
FT                   /note="C-terminal DNA-binding domain of LuxR-like proteins.
FT                   This domain contains a helix-turn-helix motif and binds
FT                   DNA. Proteins belonging to this group are response
FT                   regulators; some act as transcriptional activators, others
FT                   as transcriptional repressors...; Region: LuxR_C_like;
FT                   cd06170"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="AM1_C0017"
FT   misc_feature    order(16200..16208,16245..16253,16275..16280,16284..16289,
FT                   16293..16307,16338..16340)
FT                   /note="DNA binding residues"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="AM1_C0017"
FT   misc_feature    order(16233..16235,16239..16241,16245..16247,16338..16346,
FT                   16353..16355,16362..16367)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="AM1_C0017"
FT   gene            16820..18298
FT                   /db_xref="GeneID:5686240"
FT                   /locus_tag="AM1_C0018"
FT   CDS_pept        16820..18298
FT                   /locus_tag="AM1_C0018"
FT                   /gene_family="HOG000023188" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RND family efflux transporter MFP subunit"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340473"
FT                   /db_xref="GeneID:5686240"
FT                   /translation="MAMMVLLSACTVQAADDAKKSKASPKIAAVDVAIAKPNTDHILDS
FT                   FTGTTAPIQEVMVRSQVDGQLQKLAVEVGDRVEKGQILGQQDDGVLTDTVNTARAEREA
FT                   QVVDVAKARSQVGAAKANVEQARLALVQAKGNVLQLQNAARANIEAARLEAQQNRQDAN
FT                   RLTQLANAGATSQQEAEQARTLAQRTQQTLVNTQANSVQEITQAQTAVKTAEQALQAAI
FT                   AQVDIEQGTVNATQRRVYAQQSVLNQALGQRSFTVLSAPLTGVVMERLSEAGNLLQTGD
FT                   SILRLGDFKKIKITIQVPARLLSQLRMGQQAKITLDAFPQQEWSGKITLISPLANTTSR
FT                   LLPIEILMDNPGKMSSGLLARVSFVQPQQGRVWVPEAAIQTSQSRKGPSSTPKPSNPDH
FT                   PSSQQRPSPQPPTDRKQTPTSNQATLFVLDKASPQPRVTSRQVQLGAQRNGQVEIIQGL
FT                   TSGESFVSRSSQPLKDGATVRLSALSESSSSVNP"
FT                   /protein_id="YP_001521467.1"
FT   misc_feature    16907..18256
FT                   /note="RND family efflux transporter, MFP subunit; Region:
FT                   RND_mfp; TIGR01730"
FT                   /db_xref="CDD:162505"
FT                   /locus_tag="AM1_C0018"
FT   gene            18298..21555
FT                   /db_xref="GeneID:5686241"
FT                   /locus_tag="AM1_C0019"
FT   CDS_pept        18298..21555
FT                   /locus_tag="AM1_C0019"
FT                   /gene_family="HOG000158131" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acriflavin resistance protein, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340474"
FT                   /db_xref="GeneID:5686241"
FT                   /translation="MERSTLSLSTLSIRRHIGVFMLTLTIVVLGLFFLSTLQVDLLPSI
FT                   TYPRIGVRLEAPGISPDVAVDEITDPLEEALLATEGVVQIYSRTQEGSVSVDLYFQPGG
FT                   NIDQALNDATAALNRALNDLPDTIEQPRLFKFDPSQLPVYEMALTSPGLDDSELRVFAE
FT                   ETLNRELGLVPGVSSAEVSGAADEEIQINLDLNRMQTIGVSMTEVLNALSTRNQDISGG
FT                   QILGQLTEPLTRTIGQFQSVDEIESLILNVAALSSTNETGGAPLSTTQQALQGDQQVYL
FT                   RDIAEVVDGAAEQRVFVNLNQTPAVKLSLQKQPDANTVVVVDGIKAKLAELVQREIIPA
FT                   EMVIIPTLDESVFIRNAIRNVAISGLSGMVLAALAVLLFLGSLRQTLIIVLAIPLATLT
FT                   SIILMRLFGLSMNVFSLGGLALGVGIVVDNAIVMLETIVQGTQTQASNNGYSKQEKILR
FT                   QAEQSSRQVESALVASTSTNLVAVLPFLMIGGFIALLFNELLLTISFAISASILIALTV
FT                   VPMLASRLLMVHRSSRVGQTWLLVQFRERFERATLSYCRGLGWVLKWRWQVVVSAILIL
FT                   GISSLGMLEQIPQEILPPINTGQASLVAQFPVGTTLEQNRLVMAKVEAILAEQPETAYA
FT                   FITAGGSIRGTNLSENPLRGSGSITLKPNADVEAYTQKVSQAIDKLNLVDIRIRVSPGQ
FT                   VRGLITSNSPIRGADIDVMLQGENSQRLSQAGRQVLGALSDQVTGARFRPDNDPDQPEL
FT                   QISPDWERVAALGLSAQQIGETIQTAVEGWVPTQLQQGSRLIDIRVQLDPKSLQMEEQL
FT                   AQLPLFTEGNQFVQLADVAQIGVGAAPLEIQRINQQPVYLVGGNLAEGARLSDALAEVE
FT                   SVLTTLTLPDGVSLLPSTAAQSNRALQQALQTLGGLAAFLVFVVMAVQYNSLIDPLVIL
FT                   FTVPLALSGGLFGLYITQTAIGATVIVGVVLLVGIVVNNAIIMVELANQIYFQSGQDRQ
FT                   AAILQAAPQRLKPIMMTTMTTVLGMLPLALGIGQGSEFLQPLGIVVFAGLSLATLLTLY
FT                   IIPCFYVILHNAECQQRGLSLKTKTLPFHRLFQRLRS"
FT                   /protein_id="YP_001521468.1"
FT   misc_feature    18334..21471
FT                   /note="AcrB/AcrD/AcrF family; Region: ACR_tran; pfam00873"
FT                   /db_xref="CDD:144459"
FT                   /locus_tag="AM1_C0019"
FT   gene            21749..22207
FT                   /db_xref="GeneID:5686242"
FT                   /locus_tag="AM1_C0020"
FT   CDS_pept        21749..22207
FT                   /locus_tag="AM1_C0020"
FT                   /gene_family="HOG000034464" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340475"
FT                   /db_xref="GeneID:5686242"
FT                   /translation="MTDYPRNFKLNRTDIAISYLLLRLLIGVNFLNHGLTRIGNIPSFV
FT                   ESMVKAMENSYFPEPLVRINAFLVPVVELIVGLLIILGWQTRIALTITSGLMVILMLGV
FT                   TSVQNWQAAGDQLVYGVILFILLACRSFNTVSVDYWLKRKTTPSERSR"
FT                   /protein_id="YP_001521469.1"
FT   gene            22334..22447
FT                   /db_xref="GeneID:5686243"
FT                   /locus_tag="AM1_C0021"
FT   CDS_pept        22334..22447
FT                   /locus_tag="AM1_C0021"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340476"
FT                   /db_xref="GeneID:5686243"
FT                   /translation="MGQVLKVVWRQLLPNLPVIAAKYTWHINCFYIQCLTR"
FT                   /protein_id="YP_001521470.1"
FT   gene            22619..22822
FT                   /db_xref="GeneID:5686244"
FT                   /locus_tag="AM1_C0022"
FT   CDS_pept        22619..22822
FT                   /locus_tag="AM1_C0022"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340477"
FT                   /db_xref="GeneID:5686244"
FT                   /translation="MVGDIDLFAQECIAYATKLSAAGIPAELHVYPGGVHGFEDANPEA
FT                   RISKQFLATRDSTLKAALENQI"
FT                   /protein_id="YP_001521471.1"
FT   misc_feature    <22619..22759
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176940"
FT                   /locus_tag="AM1_C0022"
FT   gene            23424..26213
FT                   /db_xref="GeneID:5686245"
FT                   /locus_tag="AM1_C0023"
FT   CDS_pept        23424..26213
FT                   /locus_tag="AM1_C0023"
FT                   /gene_family="HOG000023189" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="two-component hybrid sensor and regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340478"
FT                   /db_xref="GeneID:5686245"
FT                   /translation="MTQAGPEPFFPPCSCHQDSFAQEGHILNRDPRVEMLLLQSSLLRE
FT                   VTNEIQQNLDTHTIFQFAVDKIQNALNADRVAIFKFDLESNYTEGIFVAEKVFPRFCSV
FT                   LATQVRDEYFGQSYVLKYQLGQVFTVTDIDDAGLSDHHIHIHKQFQVRATLVVPILLEN
FT                   QLWGLLCIHQCSGPRVWLPTEIEFVQHIAAQLSLALKQAELYEHALEKSHQLEIALHQV
FT                   EFQKEQEAWKAKVERNISEIIQRIRQSLDIEDIFGATTQDVRESLECDRVVIYQFWPDW
FT                   SGEFLVESTAPGLIPLSELDVPMTWQDTYLQENQGGKFKDNAPTVVADIYQQSYTDCHL
FT                   EILEWFDIRAYMVVPVFIGKTLWGLLAAYQLNHPRQWQKVELYLLKQAGAQLGVALQQA
FT                   ELLNQLRESKNKAEAANQAKSAFLANMSHELRTPLNAILGFSQLLARDENLTLSQKQNL
FT                   NSINRSGSHLLNLINDVLEMSKIEAGKISLNPTNCDLLLLLDSLQEMFALKAKSKGLVL
FT                   NIQKSSKIPLYIYIDENRLRQVLINLLTNALKFTESGSVTLRVSTQAISLPEESATHPQ
FT                   NDTTQPSLSLYFEVEDTGIGIAEDELDDIFDAFIQTSSGQQSQEGTGLGLAICHHFVNL
FT                   MQGDIQLQSRQGQGTTVFMQIPVCIPENKDVEEQIYENVIGLAPGQSPLRMLIVEDNLE
FT                   NLQIMHRLMTDMGFDVRTVNDGEAAISCWEAWHPHIIWMDWCLPVKNGFEATKTIRSLE
FT                   SQYRQNTVDSIAQSKHSAHPSSSLKTDLSDSRTIIIALTASVFEDTQTECKEAGCDDFL
FT                   SKPYQQSVLFELLAKHLNVKFIYSDLGSTTNVHDAQDQELITDEEVVLQLSQLSVEWLT
FT                   QIYEAAISLDEEAIGKLLTEIAVDYPYLTTKLRRLLRALRFDQIADLAENTQLLKENG"
FT                   /protein_id="YP_001521472.1"
FT   misc_feature    23586..24041
FT                   /note="GAF domain; Region: GAF; cl00853"
FT                   /db_xref="CDD:154040"
FT                   /locus_tag="AM1_C0023"
FT   misc_feature    24174..24569
FT                   /note="GAF domain; Region: GAF; cl00853"
FT                   /db_xref="CDD:154040"
FT                   /locus_tag="AM1_C0023"
FT   misc_feature    24669..24863
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="AM1_C0023"
FT   misc_feature    order(24687..24689,24699..24701,24711..24713,24720..24722,
FT                   24732..24734,24741..24743,24792..24794,24804..24806,
FT                   24813..24815,24825..24827,24834..24836,24846..24848)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="AM1_C0023"
FT   misc_feature    24705..24707
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="AM1_C0023"
FT   misc_feature    25029..25379
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="AM1_C0023"
FT   misc_feature    order(25047..25049,25059..25061,25068..25070,25191..25193,
FT                   25197..25199,25203..25205,25209..25214,25290..25301,
FT                   25347..25349,25353..25355,25368..25373,25377..25379)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="AM1_C0023"
FT   misc_feature    25059..25061
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="AM1_C0023"
FT   misc_feature    order(25203..25205,25209..25211,25290..25292,25296..25298)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="AM1_C0023"
FT   misc_feature    25482..25910
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="AM1_C0023"
FT   misc_feature    order(25491..25496,25623..25625,25647..25649,25797..25799,
FT                   25854..25856,25863..25868)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="AM1_C0023"
FT   misc_feature    25623..25625
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="AM1_C0023"
FT   misc_feature    order(25632..25637,25641..25649)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="AM1_C0023"
FT   misc_feature    25863..25871
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="AM1_C0023"
FT   gene            complement(26237..26365)
FT                   /db_xref="GeneID:5686246"
FT                   /locus_tag="AM1_C0024"
FT   CDS_pept        complement(26237..26365)
FT                   /locus_tag="AM1_C0024"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340479"
FT                   /db_xref="GeneID:5686246"
FT                   /translation="MNGMITKLLILFDYWLPYLGEYGMQLPKYLYLNLMSVVLNKI"
FT                   /protein_id="YP_001521473.1"
FT   gene            complement(26367..26504)
FT                   /db_xref="GeneID:5686247"
FT                   /locus_tag="AM1_C0025"
FT   CDS_pept        complement(26367..26504)
FT                   /locus_tag="AM1_C0025"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340480"
FT                   /db_xref="GeneID:5686247"
FT                   /translation="MLILNPFLIKSIEGMLIDTNGFGFSYLYGLRLAGCIAGATRSDGW
FT                   "
FT                   /protein_id="YP_001521474.1"
FT   gene            complement(26476..26616)
FT                   /db_xref="GeneID:5686248"
FT                   /locus_tag="AM1_C0026"
FT   CDS_pept        complement(26476..26616)
FT                   /locus_tag="AM1_C0026"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340481"
FT                   /db_xref="GeneID:5686248"
FT                   /translation="MLQSAHNRGDLRLKYQPPTQLQIASNWGIATIDAKRGHVNPQSLP
FT                   N"
FT                   /protein_id="YP_001521475.1"
FT   gene            complement(26697..27077)
FT                   /db_xref="GeneID:5686249"
FT                   /locus_tag="AM1_C0027"
FT   CDS_pept        complement(26697..27077)
FT                   /locus_tag="AM1_C0027"
FT                   /gene_family="HOG000023190" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340482"
FT                   /db_xref="GeneID:5686249"
FT                   /translation="MKKHLQLLILTSLVSALPAKANPVADACFNSLIEHPDDRPDTAVL
FT                   SLTVEHNGSQYHVIDTTYRRPQPNPASRTYIRTDDRGGCEEILSYQIGSHPEADVYRER
FT                   LGSQVFDKVRQAFRQQQQQQQR"
FT                   /protein_id="YP_001521476.1"
FT   gene            complement(27088..28317)
FT                   /db_xref="GeneID:5686250"
FT                   /locus_tag="AM1_C0028"
FT   CDS_pept        complement(27088..28317)
FT                   /locus_tag="AM1_C0028"
FT                   /gene_family="HOG000023119" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="M23 peptidase domain-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340483"
FT                   /db_xref="GeneID:5686250"
FT                   /translation="MQAKAEAEGVDLQPIDGSTGAPQLKGIPGQPGSDAAKSKFASASG
FT                   QSTGTQGTKAQTIGKSAWGSETDVHNLILTSALESTGTQNQIDVAVAIMNRVVSPKHPN
FT                   TITDVVFQPKQYEPNFGQAPVTSKEEAISRIARKTRSIQSAISTYETIEKALNDPNAIA
FT                   ASQAFLKGATDFRGQDWLHIRQPGDPYRGNTGANFYFQESQDPAIAAATLGVLGVESTA
FT                   VDPNSIYASASGHSIPCRPGAIASAGTVPFQQGSGVATGRLADPLGSHNYKLTSNYGPR
FT                   VNPVTGVPGFHYGIDLAHFAGTPFAAADGGVVVESFWNGDYGNWILIDHGNGLATWYAH
FT                   NKVNYVKAGDTVDPGQLIGEVGSTGNSTGPHIDLGVIEGYVTGNRDSGTVVNPRKYFNL
FT                   PPVGTFNQPQ"
FT                   /protein_id="YP_001521477.1"
FT   misc_feature    complement(<27922..>28173)
FT                   /note="spore cortex-lytic enzyme; Region: spore_SleB;
FT                   TIGR02869"
FT                   /db_xref="CDD:131916"
FT                   /locus_tag="AM1_C0028"
FT   misc_feature    complement(<27964..28053)
FT                   /note="Cell Wall Hydrolase; Region: Hydrolase_2; pfam07486"
FT                   /db_xref="CDD:148857"
FT                   /locus_tag="AM1_C0028"
FT   misc_feature    complement(27166..27945)
FT                   /note="Membrane proteins related to metalloendopeptidases
FT                   [Cell envelope biogenesis, outer membrane]; Region: NlpD;
FT                   COG0739"
FT                   /db_xref="CDD:31082"
FT                   /locus_tag="AM1_C0028"
FT   misc_feature    complement(27139..27450)
FT                   /note="Peptidase family M23; Region: Peptidase_M23;
FT                   pfam01551"
FT                   /db_xref="CDD:144954"
FT                   /locus_tag="AM1_C0028"
FT   gene            complement(30203..30343)
FT                   /db_xref="GeneID:5686251"
FT                   /locus_tag="AM1_C0029"
FT   CDS_pept        complement(30203..30343)
FT                   /locus_tag="AM1_C0029"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340484"
FT                   /db_xref="GeneID:5686251"
FT                   /translation="MKGCLVILLIVLTPFLLLSGPIGWILGIIAWILLLKDSGKNSGND
FT                   Q"
FT                   /protein_id="YP_001521478.1"
FT   gene            complement(30344..31792)
FT                   /db_xref="GeneID:5686252"
FT                   /locus_tag="AM1_C0030"
FT   CDS_pept        complement(30344..31792)
FT                   /locus_tag="AM1_C0030"
FT                   /gene_family="HOG000022985" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340485"
FT                   /db_xref="GeneID:5686252"
FT                   /translation="MSEIKTKKEALAAINKTKPKAKPTQPDPSQVQPQEPVPATLQDFH
FT                   LPELTHEFDAQTPTKTRRRLPIQIGVIGGSIFLILAVVQAVTSGNSDTPKPAVATRPQP
FT                   TIGMPEDDKDAIIKSQALQISELKQKYETGNVTNAPGQNKLTAVPQKPIVVPKTKPAQP
FT                   NRRPPSAAHRVTRPIQVRRSVPPSQPRIVYRNRPAPKPAVAARPPAPRPVAQAPKPAAN
FT                   FSLAQQSAFTPKPVQPARPVTPKPIRPIKVSTSHPVRKPITTKPFAKVPPTPPQGILVA
FT                   SLTGDLLEDNQVSDTPTALYPASSSPLGKGLISPGTTAKAKLDNPITWIPQNSDAIIGQ
FT                   RYLLTLSEDLGAMAKKGSKVIAEVTSAEGDFLSMQVVEVNQQPIEHVNLTDDSPEARKT
FT                   PVAVVQYKQSPYLQAKLKGQGEGFGNKLLRAGLNVGIDQLRSSSVGDRASSLVNSFAPN
FT                   RSSRSRSGLYHFDKEVEIYFVEGV"
FT                   /protein_id="YP_001521479.1"
FT   gene            complement(31792..32511)
FT                   /db_xref="GeneID:5686253"
FT                   /locus_tag="AM1_C0031"
FT   CDS_pept        complement(31792..32511)
FT                   /locus_tag="AM1_C0031"
FT                   /gene_family="HOG000022986" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340486"
FT                   /db_xref="GeneID:5686253"
FT                   /translation="MLKLQDPTETHKKQPPYVLYAILGVFTLNFFSSCGAFLSSSRSAQ
FT                   LASDQSTIYVQTQDDETVQAEKVDPLHREDALLRTYAYELVKVGWTWNGGSPPKKHNDH
FT                   IYPGELFAVAQSIDPLLRDGWLEIEHQKYEKAQQPIQEYLSGQWQSVVEIKRDTDIHLT
FT                   QIQPGQWQIHVISIRTHRSKDGKSFPEKLNKKLVVEAVIPTEGEAQRLFGDSYSQLNHL
FT                   ITKYQRHGLMITSIEDF"
FT                   /protein_id="YP_001521480.1"
FT   gene            complement(32541..33821)
FT                   /db_xref="GeneID:5686254"
FT                   /locus_tag="AM1_C0032"
FT   CDS_pept        complement(32541..33821)
FT                   /locus_tag="AM1_C0032"
FT                   /gene_family="HOG000022988" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340487"
FT                   /db_xref="GeneID:5686254"
FT                   /translation="MSVIGLTLLFIALGEVSAHAINEDLDPSVGVDLLRQSKIRMFETS
FT                   QWWDELWNDILGDNPRTTVNNKAMFSILLPFLLVACLVLMARAGYSFLSGETHRIVLQQ
FT                   IVPIVLLLAFTLNYGWGAKAVAWSFREVANRGSELILDSQWAGLVVRDALKDKIHAASA
FT                   IAEYNRQSASCSRLPAITLRDPAAASSSQGLDQVQASKVQTAVRCLELLAQKLERDEAA
FT                   IKKDCPSCETAQQVIESRKKGIQADLGRISAAIFNTLNPIDDAIHGFNVVKENAVRTVS
FT                   IEGPLQIQYWFVSGQELALILSGILAPIMIIYSTLPIAGHKWAVLQYLKALVIIALVRF
FT                   AYIFVIGFGAIYLTDNPIADQGAAFATFLGYVAPAVATAAVTVGALAASGVYTGAVVTT
FT                   VGAAVTVVSSAALSASSAVTSRALRNR"
FT                   /protein_id="YP_001521481.1"
FT   gene            complement(33829..34980)
FT                   /db_xref="GeneID:5686255"
FT                   /locus_tag="AM1_C0033"
FT   CDS_pept        complement(33829..34980)
FT                   /locus_tag="AM1_C0033"
FT                   /gene_family="HOG000022989" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340488"
FT                   /db_xref="GeneID:5686255"
FT                   /translation="MQPKPLLITLVLSVQATITTVPAYAQVSYDDPVISGDITLPTTTA
FT                   PTTFPDVPIPTGDVTIAKDNPLDTATYTEVPTAQLPSGLLGTVFNVLGPKQKPGQARVI
FT                   NETQRKILKVYEYGQKALDAYKVGRAIYDAIDNFSLKRILSGSVSSILANYDKLGTNGT
FT                   SGSQQGGSGSEDPIYSDPQDPFQVYTQARNNEARKALLPQLMTQLVFSEDGQALIQQQG
FT                   EQVQQSVVNTIESTQALVQLSAASKEQATAGAGIATSVGETGQKAQTLKSSQAVLKSLT
FT                   AQNSLMAQGTATNGAILSNVVSGQEEQKKSSDALVVGSALAHQQRTTGLHLSASELTLQ
FT                   EQIRAELELYKDERHRAQDQAALREQLSFNYLYIPGLYSETTP"
FT                   /protein_id="YP_001521482.1"
FT   gene            complement(34970..38116)
FT                   /db_xref="GeneID:5686256"
FT                   /locus_tag="AM1_C0034"
FT   CDS_pept        complement(34970..38116)
FT                   /locus_tag="AM1_C0034"
FT                   /gene_family="HOG000022990" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340489"
FT                   /db_xref="GeneID:5686256"
FT                   /translation="MDFEAVNEGQTRDILSVNTMLDGIPVFYLGASIAVLGVGFAVLIK
FT                   FGFLLAVLFIALTSIGIILIFGRNPSQQMERVGKPTTYMDGRPSLRFDNVGMPVMAKAK
FT                   KTDPLRRIQDNFCLKTYGQFEFEGVTVGFHLHHWNSREIKIAFMFDVLGLDPTVTPAQS
FT                   KQQLNKSNQKICHLGGTDLKAILDVRADCSDPLIATATALGKATDALTTAQLQSDAENL
FT                   QSLEAEGRIAKSRLLYQAKCRMRLGGDYDTPDSPADVVFEWVSGFWNDTVAQKVMGEAY
FT                   QSKEQWEKAIFAAYTNSYRRMTRMLTGAEGLGHKIQPLTAQELFDWDYAELHEESIPIP
FT                   QYTRYDDLGLDPNPVVSEHHLHSLGVLFEPEKGKPAVPQFGESLAYLPSKGKYVGALRF
FT                   EGLRTIPEVQDSTELGFIKFLFDTLATPGELFLDARVVTELLPIKSGLTRAILEQTGRN
FT                   SIRKMGDAAQRKELNPIALERLEETKKNLEWMNNGNRPFWIAFAIFLYRDSVDQLNLDL
FT                   DALAQKLEGTKAVKITQKFEHHWCTSLAISAAPMLTLPGGGNHLYKTMSPRVLPTLPQI
FT                   HPAPMDRRGVLLIGYDLPIPFYLDLAHTFPNHTLVTGETGAGKTMLMLEMTSYCQREGM
FT                   NVVGFDFPPPTGKSSYEPYMKTQEQLNVSSTYQPVDKATINVMETPDVSWIDDLPKPGE
FT                   PGYDYQQPTHEEAWKFIKRNKLRILKAIALGEAGQSSPMEDLLIERALGLCFDAFHQAN
FT                   LERYTKASIAPFGSAEAAQMPIYEEFVAFAKSWLNQYIQDNDCGPDLQRTFENLQLLLE
FT                   GVIPTALGDSINGISSFDANVDALMLGLTNVDNDSDSLVYGVAGFDLLIRKAMNGKRTL
FT                   LPVDEGSELLTRPIFAEMVGSLANSGRKWKCNILIGMTEVKTLLNSSCSSKVISNLQNK
FT                   LVSYVNKYARELLVSEFGFQAEILKKFEHDSFKASETLQQSHWCWQRGSRQLIVTHNPS
FT                   NFTLGVGSNQGKQTEARNRVMSRYPDDPVAGLVDFGDQLSQANKQGIEVETIGVEDHAA
FT                   "
FT                   /protein_id="YP_001521483.1"
FT   misc_feature    complement(<36176..36343)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="AM1_C0034"
FT   gene            complement(38129..38680)
FT                   /db_xref="GeneID:5686257"
FT                   /locus_tag="AM1_C0035"
FT   CDS_pept        complement(38129..38680)
FT                   /locus_tag="AM1_C0035"
FT                   /gene_family="HOG000022991" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340490"
FT                   /db_xref="GeneID:5686257"
FT                   /translation="MKRLKILYEKTSKQPWWFGYSGFLIIGLIYNLPWLQATSLACLAI
FT                   TASAIAWRRIIRRSPHVLAGLQTVSITIGYQQYAQAQLNVPDSVCNGFDVIPGFGKAMI
FT                   GGLGWLNVQGFSLAGAVCGIGWLILAGVVLGAIGFAGKNSLGHSHHGGDIQEMSRPVVG
FT                   LLYFIIVMIMIGALIFAATR"
FT                   /protein_id="YP_001521484.1"
FT   gene            complement(38716..40809)
FT                   /db_xref="GeneID:5686258"
FT                   /locus_tag="AM1_C0036"
FT   CDS_pept        complement(38716..40809)
FT                   /locus_tag="AM1_C0036"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA polymerase sigma-2 subunit"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340491"
FT                   /db_xref="GeneID:5686258"
FT                   /translation="MTTTTIASPFSDGIRLPEYLVQFLHRFPIPDPEQELDLIRKAKRG
FT                   HETSLSWLMIGHVRLVAKLAKQYAWTLDDAQDLIQEGMLGIRHAVGKFDSTKGCKFSTY
FT                   ARGWIRGYIRRFCYKNRPKQLRLPEKKQVHLDRVYRLQNEFPDANLEEIARKANLKLEY
FT                   IEDLLYWGRSFQEIPDWHEFVIDDASFYTDDEEYDEYFDIELEPETKTNLVLIKAPPPF
FT                   IPPKYQIPIHLLKQWFRVGLAQFVNAAKDQLEHTRLGFSQSFSRSSPSTAPEVGQERVN
FT                   LNTWPAPLSFCYENSINPYAYSQAPPAIESLSAKAINLVKGVIAHAQESLLVLCGGRSD
FT                   GSTDRPGHQPSPADQRCRGLGEPGTTGRGHLGFCQAVTEFIHRPLATISDCLRGFPSRA
FT                   GPDTSQQPQRGAVFDSNPPPQQMHLPRKNAMYKTIAAMIAAWLGLLISPATAETIKIAP
FT                   GHGHLIDLTASGCRVSKAYMGTRGIFDLSLDRPQPQTQKIYLTWKPNTQVKSTNLIQDL
FT                   VGCNRSSMELTINRSDSAPSTAITRIGTPTPIAHTPEQSRVFTGRLGQPPERTRVHQAS
FT                   TAVQPLTLKPQAQTLPKPKIVKRPPVRRVPLTQKVKPIPTANIPLTKTNVSDSRITPAT
FT                   LLRGLNIARASGNQTYSYLSEMHWRVNGMIRQMRWGAKADVAAKRAKISPDQLQTLLNY
FT                   AQQ"
FT                   /protein_id="YP_001521485.1"
FT   misc_feature    complement(<40306..40785)
FT                   /note="DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32) [Transcription]; Region: RpoD; COG0568"
FT                   /db_xref="CDD:30914"
FT                   /locus_tag="AM1_C0036"
FT   misc_feature    complement(40447..40641)
FT                   /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
FT                   /db_xref="CDD:146937"
FT                   /locus_tag="AM1_C0036"
FT   gene            complement(40843..41013)
FT                   /db_xref="GeneID:5686259"
FT                   /locus_tag="AM1_C0037"
FT   CDS_pept        complement(40843..41013)
FT                   /locus_tag="AM1_C0037"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340492"
FT                   /db_xref="GeneID:5686259"
FT                   /translation="MTDRNSSDHNLQPNPILSHAQIWGKTGHGKVALAISDEHSPTPSH
FT                   LKINFHPKPSR"
FT                   /protein_id="YP_001521486.1"
FT   gene            complement(41050..42276)
FT                   /db_xref="GeneID:5686260"
FT                   /locus_tag="AM1_C0038"
FT   CDS_pept        complement(41050..42276)
FT                   /locus_tag="AM1_C0038"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340493"
FT                   /db_xref="GeneID:5686260"
FT                   /translation="MQVAIAKIGDATLLVTPDGKPVPHKDTEQPTFHIQPQLFNPYCDI
FT                   GLSDISLVGATIAPHDSTKPVSVLPKDVTIRQPYPNENYYVAGMAERKMGWDIPLDLDA
FT                   APKWLDLTWEVRTPSDIEHSILTIYHRFTLEFILTQQGQVFSMDQANTFYDPNARTISH
FT                   ISLNHIDDSFTKGDKSFKSYRMDSPHGLAFYQTLILNSCAWSDLICTAQEDVTLLRDIE
FT                   PAQSFQTHIDLHRQNACIEIPADVLHQAICDTQVEVDFEIGEYDRSPGLQRLCRWWNEN
FT                   APVVGTRRAAFIALWCRVEDDDWYWSGWDECPEWGVENIQRYGLQDRCARWNDFVILEF
FT                   FPRQVSRLEVAQGASTEILGVDGKGYTDTGLAREDVDEAYHAHYSLQAFPKRFPFAWKT
FT                   LQAAVHTPA"
FT                   /protein_id="YP_001521487.1"
FT   gene            complement(42364..42804)
FT                   /db_xref="GeneID:5686261"
FT                   /locus_tag="AM1_C0039"
FT   CDS_pept        complement(42364..42804)
FT                   /locus_tag="AM1_C0039"
FT                   /gene_family="HOG000022992" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340494"
FT                   /db_xref="GeneID:5686261"
FT                   /translation="MLTINTDSGKSRGGSNDLQNSDQLDPQVIQEYRERYLQIAWKVQG
FT                   LMSMPVLYTYDQLYRHGCDHPKLSERIDALVSLELRLSGYSKDDQVNILLYGPYIQAQM
FT                   LDHSMSESGARDYIRQRLAIAPTPPAPLKELSQIQVAPTTAA"
FT                   /protein_id="YP_001521488.1"
FT   gene            complement(43387..46911)
FT                   /db_xref="GeneID:5686262"
FT                   /locus_tag="AM1_C0040"
FT   CDS_pept        complement(43387..46911)
FT                   /locus_tag="AM1_C0040"
FT                   /gene_family="HOG000023186" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340495"
FT                   /db_xref="GeneID:5686262"
FT                   /translation="MSSFQNISSKLLATNRSNPCDLCGDITGKCRKAGNLNLCMTLSGK
FT                   IEGYRYLGQSKDGLWGKYVLDDGEDLSQEDWERRWQEQRILREQRAQVEAQRHAQSLPA
FT                   IERDRLYRQLLDQLTLHPADRADLHRRGFTNEQIQDWGVKSVEQWQPLSGELPHDLPGI
FT                   NLDGKSLNTPRPGYLCPIMDADGQIVGFQIRSRSSEGGRYFWLTGKTRKRPNGPTPHLR
FT                   NGELPLAIHRPEQITRDAFALVEGTGAKPHLLAQRMGQVTIGAAGGLFAASPETLKATL
FT                   AQLGITTIEFYPDAGAIQNKSVLRQYRSTWALLKEWGYTVTVAWWKQTDKRIHTDIDEL
FT                   DDLSQIQYLSVADFERIAAQCNGLLHQLQQALSKLTRPSSPAQGFATPNDQQTHPTESR
FT                   RTKRTAPDEERLATLPATSRRARRSRRRTARLLAAHRRHGYISKLRLENYRSRIRRRTA
FT                   QSANSRSSSLQSCPGDNGTLSPTTPLVHEYQPGQRLQTWETLISSGFPYILDQSQPGTG
FT                   KSYDSGNVTPIGFGMEQVIYLSDQHRNPTVSTLEQGNGWCDLEARHGGLNRVKNRLQRS
FT                   AKGDAFAVPANCSRIGVLNALRDKNIPGADTANLICGTCIAREACINADGPGYGFLNQR
FT                   RNVLGTPLLRAHPDSLPDPEDYPLENTMLIWDEPGQNFQVKQSVTVTFNDLQQTISGLI
FT                   AYPEIFALVQPLLSALLPLMDGSEKLGKYGLNHLEMKAKLPDMAGVKLGELTQVLMPNL
FT                   GFLNTTSDYGVDLADLPKQLRKKFSERDSEMAEQARNGVVKQWLIPLIRILQGGAGCIQ
FT                   VSRYGLLTLNTPNPRHRDLAQAAQANVFLDATLSREDLALKLGCSPDEILVVRQAVPDT
FT                   GNLEVIQVKDMGRVGMSRGGDQTKRIGALAQHYQDLDAVNTRTIDFKKFEKDGAWWRDS
FT                   RGVNDFLTVQTLVLVGTPCRNLNDLAAEFAIVCGYYPEEDNPAFTAFIDRSILAEIHQA
FT                   IGRLRAHRRPHESLQVVLISNIEMDCFVQEVQAKELTLDAAHKTERVEIAIESAILQLQ
FT                   AKGEKVTQQIVSAMTQIPRGTIARYWRLFISLLKGLNSKMNNLCNAPNPNQETHQAIAG
FT                   VLDELADLPVNDLLPSLNEVFFDWLKPKEWSSVWSEVSASGQMAILEGLAMTLPVKMLE
FT                   RGMPELAA"
FT                   /protein_id="YP_001521489.1"
FT   gene            complement(47591..48616)
FT                   /db_xref="GeneID:5686263"
FT                   /locus_tag="AM1_C0041"
FT   CDS_pept        complement(47591..48616)
FT                   /locus_tag="AM1_C0041"
FT                   /gene_family="HOG000022994" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340496"
FT                   /db_xref="GeneID:5686263"
FT                   /translation="MDGGTQPRAQLFEEVVAEYAEDMKQGAIFPPVIVYYDGEEYWLAD
FT                   GFHRVRARETIGSKDVTADVRLGTQRDAVLYAVGANAAHGLRRTNADKHRAVKRLLRDK
FT                   EWMKWSDREIARRCGVANSFVGRIRKSLSVPEEQINHDAEGLDLDPSVRLAKRGGTIFE
FT                   MDTTNIRDRPQTEQKKSIKRSRAKKQPVSPKPLEGKPIEVKEGDTWKLGKSHYLFCGEG
FT                   SSRKFLKLFPPEVALLLYFPRQREDWTQAITLQARSTLLFHTFYGEDIDLKNLRKIIEN
FT                   CLSTTTDADDSIVVINLADPLLFILMESLFCSCYCAEPDPQRCTDALAAWAAIKQPVKK
FT                   L"
FT                   /protein_id="YP_001521490.1"
FT   misc_feature    complement(48374..48601)
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="AM1_C0041"
FT   gene            complement(48768..49229)
FT                   /db_xref="GeneID:5686264"
FT                   /locus_tag="AM1_C0042"
FT   CDS_pept        complement(48768..49229)
FT                   /locus_tag="AM1_C0042"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340497"
FT                   /db_xref="GeneID:5686264"
FT                   /translation="MSYSKVDNSFTNLKLSDITLDNEIQSYQQLIQEVVGEFAEAMRQG
FT                   AKFPPVVVFFDGDNYWLADGLHRFLAKQFVAEQSISTEVQPGSRYDANFYSARSNLNPS
FT                   DIHSSEEKHRFFENILYDGQSEPLQYLDQSPNRSRRKRGQTIATNIRTL"
FT                   /protein_id="YP_001521491.1"
FT   gene            49780..50832
FT                   /db_xref="GeneID:5686265"
FT                   /locus_tag="AM1_C0043"
FT   CDS_pept        49780..50832
FT                   /locus_tag="AM1_C0043"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340498"
FT                   /db_xref="GeneID:5686265"
FT                   /translation="MDKEWDLQRLYSDLEMVNKQSLSNSAKQYLEYILLGQSPSNIAET
FT                   LNPESRQSSGTIRTVLSRDVYPSLILLLNLPEDYRMRWNKVPMLLSQYKIAKREACSSS
FT                   PSYIHYEKNQNSYVGSCQIKSDIINGLLKKYFLKKGFTEDFLSSNTKSMSFRSEWQTIV
FT                   NKLVSETRETLLAMVLDTELKKWWSSIAGMMYMATNVNLLKNGVKIKRIFILNSLDFRI
FT                   RNNAIMNAYLHEKMGVEVKILDNIDCKIKMFIDADMISVHDKELIALYYLSEDCEITEL
FT                   LLDYCSISAFSSFYDELFDDDRLCENVDKIISNSNLSSSFFSDIEHQINYLKRISCSTS
FT                   VKEFLGILPN"
FT                   /protein_id="YP_001521492.1"
FT   gene            50837..51295
FT                   /db_xref="GeneID:5686266"
FT                   /locus_tag="AM1_C0044"
FT   CDS_pept        50837..51295
FT                   /locus_tag="AM1_C0044"
FT                   /gene_family="HOG000014565" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340499"
FT                   /db_xref="GeneID:5686266"
FT                   /translation="MKSTELKTGRTFGVTFEHQSDFFQELSSFCKENQVQQGYIPMFIA
FT                   GFSEVELVGTCSKIDDVNAPVWDKVHLSNVEACGCGTIAYDSDEDKISPHIHVNTGIKS
FT                   YSASGHTSHLLSAKVLFLVEMLIVEVLQPDMRRVVDPNLYNIGLLQFI"
FT                   /protein_id="YP_001521493.1"
FT   misc_feature    50837..51262
FT                   /note="Domain of unknown function (DUF296); Region: DUF296;
FT                   cl00720"
FT                   /db_xref="CDD:153955"
FT                   /locus_tag="AM1_C0044"
FT   gene            51334..52143
FT                   /db_xref="GeneID:5686267"
FT                   /locus_tag="AM1_C0045"
FT   CDS_pept        51334..52143
FT                   /locus_tag="AM1_C0045"
FT                   /gene_family="HOG000222700" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="carbon-nitrogen hydrolase family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340500"
FT                   /db_xref="GeneID:5686267"
FT                   /translation="MKVGFIQFSPILGKPTQTLERLEYLIDKGKHSDILVLPELCNSGY
FT                   AFNSRQQALNSSESVADSKFIRFLHEKSNKYNLYIVSGFCEKSDKDLYNSSFLVGPNEY
FT                   IEVYRKSHLFLNEKDFFSPGNTDYSVYDIGICKIGMLICFDWVFPEAWRILALKGADII
FT                   CHPSNIVLPDLCQKTIPGHSICNRMFIVTANRIGTEDNLTFTGSSIICDPRGNILTQAS
FT                   DDQEEVMISDIDLNLARDKSITSRNHIFLDRRPDKYLDIAKAIEESV"
FT                   /protein_id="YP_001521494.1"
FT   misc_feature    51334..52122
FT                   /note="Predicted amidohydrolase [General function
FT                   prediction only]; Region: COG0388"
FT                   /db_xref="CDD:30737"
FT                   /locus_tag="AM1_C0045"
FT   misc_feature    51337..52107
FT                   /note="Pyrococcus horikoshii Ph0642 and related proteins,
FT                   members of the nitrilase superfamily (putative class 13
FT                   nitrilases); Region: Ph0642_like; cd07577"
FT                   /db_xref="CDD:143601"
FT                   /locus_tag="AM1_C0045"
FT   misc_feature    order(51448..51450,51661..51663,51673..51675,51682..51684,
FT                   51760..51765,51769..51774,51835..51837,51841..51846,
FT                   51856..51858)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:143601"
FT                   /locus_tag="AM1_C0045"
FT   misc_feature    order(51448..51450,51661..51663,51760..51762)
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:143601"
FT                   /locus_tag="AM1_C0045"
FT   misc_feature    order(51664..51681,51685..51690,51697..51708,51712..51717,
FT                   51727..51729,51763..51765,51769..51783,51790..51795,
FT                   51802..51807,51844..51846,51853..51855,51862..51867,
FT                   51871..51879,51883..51888,51973..51978,52060..52074,
FT                   52078..52080,52084..52107)
FT                   /note="putative tetramer interface; other site"
FT                   /db_xref="CDD:143601"
FT                   /locus_tag="AM1_C0045"
FT   misc_feature    order(51664..51681,51685..51690,51700..51708,51712..51717,
FT                   51763..51765,51769..51783,51790..51795,51802..51807,
FT                   51844..51846,51853..51855,51862..51867,51871..51879,
FT                   51883..51888,51973..51978,52060..52074,52078..52080,
FT                   52087..52098,52102..52107)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:143601"
FT                   /locus_tag="AM1_C0045"
FT   gene            complement(52244..52558)
FT                   /db_xref="GeneID:5686268"
FT                   /locus_tag="AM1_C0046"
FT   CDS_pept        complement(52244..52558)
FT                   /locus_tag="AM1_C0046"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="single-stranded DNA-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340501"
FT                   /db_xref="GeneID:5686268"
FT                   /translation="MNTCTFQGILLERSLRYTQERRAIAEFVVEINPLMEEDPKENLKA
FT                   IYWGENGEQAHNALQAGDQLVLQGQLRINKVTHRLGNEEYVEQQASVIVEKINRIQSPG
FT                   "
FT                   /protein_id="YP_001521495.1"
FT   misc_feature    complement(52268..52516)
FT                   /note="SSB_OBF: A subfamily of OB folds similar to the OB
FT                   fold of ssDNA-binding protein (SSB). SSBs bind with high
FT                   affinity to ssDNA. They bind to and protect ssDNA
FT                   intermediates during DNA metabolic pathways. All bacterial
FT                   and eukaryotic SSBs studied to date...; Region: SSB_OBF;
FT                   cd04496"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="AM1_C0046"
FT   misc_feature    complement(order(52280..52282,52286..52288,52334..52339,
FT                   52343..52345,52349..52351,52373..52378,52415..52417,
FT                   52418..52420,52424..52429,52457..52462,52481..52483,
FT                   52511..52513))
FT                   /note="ssDNA binding site; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="AM1_C0046"
FT   misc_feature    complement(order(52289..52291,52307..52309,52340..52342,
FT                   52367..52369,52421..52423,52460..52468))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="AM1_C0046"
FT   misc_feature    complement(order(52355..52357,52361..52363,52367..52369))
FT                   /note="tetramer (dimer of dimers) interface; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="AM1_C0046"
FT   gene            52684..53505
FT                   /db_xref="GeneID:5686269"
FT                   /locus_tag="AM1_C0047"
FT   CDS_pept        52684..53505
FT                   /locus_tag="AM1_C0047"
FT                   /gene_family="HOG000022995" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340502"
FT                   /db_xref="GeneID:5686269"
FT                   /translation="MPSATIDKLNQLKVQLKQCNNDTAALLLKRTIAKLESQLQREQLT
FT                   TQSAKIPSKEIPKVSQAIFKQQSLVQDKKVVPQQQQITKNLQAKSKQRNHRKKRRPLLP
FT                   GNGTHRAWCRIPGIIRVQEVEGEGEQPVYFIELDGHQLPLRVKKRFSKLIGASLDTPLM
FT                   VKCYPQIIEGQIVFLQFCGAAEPTPETPEDWVMIGVWNSENQRVLVQRDQRCDQSRRIL
FT                   QHSPLVKEACLEKLEAGKLYRYQCQREGITVTIVGVEVVEGEEGKIVQEAS"
FT                   /protein_id="YP_001521496.1"
FT   gene            complement(53557..53802)
FT                   /db_xref="GeneID:5686270"
FT                   /locus_tag="AM1_C0048"
FT   CDS_pept        complement(53557..53802)
FT                   /locus_tag="AM1_C0048"
FT                   /gene_family="HOG000276232" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340503"
FT                   /db_xref="GeneID:5686270"
FT                   /translation="MRPLVQQDLNAVFAEYGTVKQVKMPTDRETGRKRGFAFVEMGNDA
FT                   EEAKAIDELEGAELMGRTLKVNKARPHENRGGGNRW"
FT                   /protein_id="YP_001521497.1"
FT   misc_feature    complement(53599..53784)
FT                   /note="RRM (RNA recognition motif), also known as RBD (RNA
FT                   binding domain) or RNP (ribonucleoprotein domain), is a
FT                   highly abundant domain in eukaryotes found in proteins
FT                   involved in post-transcriptional gene expression processes
FT                   including mRNA and rRNA...; Region: RRM; cd00590"
FT                   /db_xref="CDD:100104"
FT                   /locus_tag="AM1_C0048"
FT   misc_feature    complement(order(53689..53691,53695..53697))
FT                   /note="RNA/DNA binding site; other site"
FT                   /db_xref="CDD:100104"
FT                   /locus_tag="AM1_C0048"
FT   misc_feature    complement(53599..53607)
FT                   /note="RRM dimerization site; other site"
FT                   /db_xref="CDD:100104"
FT                   /locus_tag="AM1_C0048"
FT   gene            complement(53775..53936)
FT                   /db_xref="GeneID:5686271"
FT                   /locus_tag="AM1_C0049"
FT   CDS_pept        complement(53775..53936)
FT                   /locus_tag="AM1_C0049"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340504"
FT                   /db_xref="GeneID:5686271"
FT                   /translation="MLVEARLGSKGECQKIDDFLSGFQYHNLEVMQEKGFRRKRYFLFK
FT                   CARWSNKT"
FT                   /protein_id="YP_001521498.1"
FT   gene            54103..54990
FT                   /db_xref="GeneID:5686272"
FT                   /locus_tag="AM1_C0050"
FT   CDS_pept        54103..54990
FT                   /locus_tag="AM1_C0050"
FT                   /gene_family="HOG000244136" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methylated DNA-protein cysteine
FT                   methyltransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340505"
FT                   /db_xref="GeneID:5686272"
FT                   /translation="MGLRRLTPEDDPSDHYQMVAAAIAFIREHRFEQPALSTVAQHIGL
FT                   SEYHFQRLFTYWAGISPKRFLQYLTIEQAKATIAQTDSLLTLSEDLGLSGPSRLHDLFV
FT                   SIEAMSPGEYKNGGEGLEIYNGSHNTLFGTVVIATTKRGICSLQFQDKATLPVDDLLTN
FT                   TWPNATLTVDQEKTQGLCDRIFLPEMSQPTKPLTLLVKGTNFQVQVWRALLQIPLGGLT
FT                   TYQTIAEMIERPKAARAVGTAIGKNPIGYLIPCHRVIRGSGEIGGYSWGLDRKQAILGW
FT                   EAAQLNHSTIQEGS"
FT                   /protein_id="YP_001521499.1"
FT   misc_feature    54109..54450
FT                   /note="AraC-type DNA-binding domain-containing proteins
FT                   [Transcription]; Region: AraC; COG2207"
FT                   /db_xref="CDD:32389"
FT                   /locus_tag="AM1_C0050"
FT   misc_feature    54469..54954
FT                   /note="Methylated DNA-protein cysteine methyltransferase
FT                   [DNA replication, recombination, and repair]; Region: Ada;
FT                   COG0350"
FT                   /db_xref="CDD:30699"
FT                   /locus_tag="AM1_C0050"
FT   misc_feature    54715..54948
FT                   /note="The DNA repair protein O6-alkylguanine-DNA
FT                   alkyltransferase (ATase; also known as AGT, AGAT and MGMT)
FT                   reverses O6-alkylation DNA damage by transferring O6-alkyl
FT                   adducts to an active site cysteine irreversibly, without
FT                   inducing DNA strand breaks. ATases...; Region: ATase;
FT                   cd06445"
FT                   /db_xref="CDD:119438"
FT                   /locus_tag="AM1_C0050"
FT   misc_feature    order(54715..54720,54772..54777,54799..54801,54808..54810,
FT                   54814..54819,54823..54825,54832..54837,54841..54843,
FT                   54865..54867,54880..54882,54901..54903)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:119438"
FT                   /locus_tag="AM1_C0050"
FT   misc_feature    order(54772..54774,54865..54870,54874..54876,54946..54948)
FT                   /note="active site"
FT                   /db_xref="CDD:119438"
FT                   /locus_tag="AM1_C0050"
FT   gene            54990..55871
FT                   /db_xref="GeneID:5686273"
FT                   /locus_tag="AM1_C0051"
FT   CDS_pept        54990..55871
FT                   /locus_tag="AM1_C0051"
FT                   /gene_family="HOG000253120" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340506"
FT                   /db_xref="GeneID:5686273"
FT                   /translation="MRLSDVLELLLLSALWGGSFLFMRIAAPVLGPIWLIECRVLFAGL
FT                   ALLPLLLRSQAWSMICANLKSLFIVGSINSALPFLLLAFASLSLPAGYTSIVNATAPLF
FT                   GTLIATTWLHEKLTAARMVGLLSGFAGVVLLIGLQPMEITPVVIGSIVAGLLAAIMYAI
FT                   AAPFAKRRLSGIPPLVIATMTQLSAAVALLPLLPFTLPAAMPSTTIMLAVLALAFFSTS
FT                   LAYLLYFRLIQNIGASKALTVTYLVPIFAVLWGAVFLREAITVAMISGCCLILLGTAIA
FT                   NGLLFSASQRNL"
FT                   /protein_id="YP_001521500.1"
FT   misc_feature    <55605..55835
FT                   /note="EamA-like transporter family; Region: EamA; cl01037"
FT                   /db_xref="CDD:154161"
FT                   /locus_tag="AM1_C0051"
FT   gene            complement(55983..56918)
FT                   /db_xref="GeneID:5686274"
FT                   /locus_tag="AM1_C0052"
FT   CDS_pept        complement(55983..56918)
FT                   /locus_tag="AM1_C0052"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340507"
FT                   /db_xref="GeneID:5686274"
FT                   /translation="MKSLSNIKTFVRVAEVESFARASNILGLSTSAVSKAVARLEADLG
FT                   VKLFHRTTRSVSLTPDGKQFYEGCQQLLLEFDALTAEVQGSRATPRGQLTISAPAAFGR
FT                   LCLVPLLQSFMQSYPEITLNISIDDHAIDLAAQGIDIVIRTGQLADSANLIASRLVTYR
FT                   LVVCASPHYLAEHGEPQHPEQLQRHSCLNFRNPDTGRFFPWVLEIDGAVESYTVSGPLV
FT                   FDNADAVVRSSISSLGLSQMPSFLAKEAVSRGQLVEVLNSYQPPETPVWICYLDRNFVS
FT                   PRIRAFVEFMKSEKSHLSTMCSLAERIAVS"
FT                   /protein_id="YP_001521501.1"
FT   misc_feature    complement(56037..56912)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="AM1_C0052"
FT   misc_feature    complement(56730..56909)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="AM1_C0052"
FT   misc_feature    complement(56046..56645)
FT                   /note="The C-terminal substrate binding domain of LysR-type
FT                   transcriptional regulator CrgA and its related homologs,
FT                   contains the type 2 periplasmic binding domain; Region:
FT                   PBP2_CrgA_like; cd08422"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="AM1_C0052"
FT   misc_feature    complement(order(56109..56111,56190..56192,56241..56243,
FT                   56433..56435,56439..56441,56484..56486,56601..56603,
FT                   56613..56615))
FT                   /note="putative effector binding pocket; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="AM1_C0052"
FT   misc_feature    complement(order(56214..56216,56223..56228,56247..56261,
FT                   56352..56354,56538..56558,56562..56564,56574..56576,
FT                   56583..56588,56592..56597,56607..56612))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="AM1_C0052"
FT   gene            57058..57591
FT                   /db_xref="GeneID:5686275"
FT                   /locus_tag="AM1_C0053"
FT   CDS_pept        57058..57591
FT                   /locus_tag="AM1_C0053"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340508"
FT                   /db_xref="GeneID:5686275"
FT                   /translation="MKYTTNKTEASNTETLSSDELKAALAESERIGRQIYTGFNERKLD
FT                   LWDDVIASDVQLRSTVGDQPQYGLEALKNWTAEFHKAFQPRLDLVDEIYGVNRATIAVN
FT                   LIWQHVDEFFGLAPTGRKGTSIEYFILTHAEGKVTHYWVADHSLDLASYLTHERGLHYP
FT                   QNFEPEPIIRGIDF"
FT                   /protein_id="YP_001521502.1"
FT   misc_feature    57154..57483
FT                   /note="Nuclear transport factor 2 (NTF2-like) superfamily.
FT                   This family includes members of the NTF2 family,
FT                   Delta-5-3-ketosteroid isomerases, Scytalone Dehydratases,
FT                   and the beta subunit of Ring hydroxylating dioxygenases.
FT                   This family is a classic example of...; Region: NTF2_like;
FT                   cl09109"
FT                   /db_xref="CDD:175003"
FT                   /locus_tag="AM1_C0053"
FT   gene            57675..58619
FT                   /db_xref="GeneID:5686276"
FT                   /locus_tag="AM1_C0054"
FT   CDS_pept        57675..58619
FT                   /locus_tag="AM1_C0054"
FT                   /gene_family="HOG000294678" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase family
FT                   protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340509"
FT                   /db_xref="GeneID:5686276"
FT                   /translation="MQRIIMNSDQEGGLSFVETDSLQPLPHQSLIKVTAFSLNRGEINI
FT                   AQSPTSGGRSIGWDFVGVIENSAADGTGLKKGTRVVGWRPEMDAFAEYVIGEHQFIAPI
FT                   PDAVSDVQAATLPVAGLTALAAVDQGNRLVGNSALVTGVTGGVGYFALQLAKLSGARTV
FT                   AQVRRSEQATFASNIGADAVVVTEDGSGLEGEGPYHLVVDGVGGQLFSSLLSVTAKGGT
FT                   LVSYGSSESHESTVNLYPALFGNGGQRRIYGLTLYSEIEKEPSSAALTRLLNLVERDLL
FT                   KLPETITSDWSETPHLAEDLLARKFTGKAVLTL"
FT                   /protein_id="YP_001521503.1"
FT   misc_feature    57675..58616
FT                   /note="Medium chain dehydrogenases/reductase
FT                   (MDR)/zinc-dependent alcohol dehydrogenase-like family;
FT                   Region: MDR4; cd08270"
FT                   /db_xref="CDD:176231"
FT                   /locus_tag="AM1_C0054"
FT   misc_feature    57675..58613
FT                   /note="NADPH:quinone reductase and related Zn-dependent
FT                   oxidoreductases [Energy production and conversion / General
FT                   function prediction only]; Region: Qor; COG0604"
FT                   /db_xref="CDD:30949"
FT                   /locus_tag="AM1_C0054"
FT   misc_feature    order(57789..57797,57804..57806,58026..58028,58038..58040,
FT                   58098..58109,58113..58118,58170..58175,58176..58178,
FT                   58236..58238,58284..58289,58293..58295,58350..58355,
FT                   58425..58433)
FT                   /note="putative NAD(P) binding site; other site"
FT                   /db_xref="CDD:176231"
FT                   /locus_tag="AM1_C0054"
FT   gene            complement(58753..59643)
FT                   /db_xref="GeneID:5686277"
FT                   /locus_tag="AM1_C0055"
FT   CDS_pept        complement(58753..59643)
FT                   /locus_tag="AM1_C0055"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340510"
FT                   /db_xref="GeneID:5686277"
FT                   /translation="MESLEIFRAVVDAGSFTAAGGVLNKDKAHVSRVVSRLEKRLGVQL
FT                   LKRSTRRLNITEIGRDFYERACGILAALEETEASIAHAQGEPRGVLRVTAGAEFGPMRV
FT                   NYWIAEYLKRYPEVRVEADFSDRIVDVIHEGIDVAIRVGPLVDSELSVRPLGEIRYGLY
FT                   ASPAYAHTRGEPKSLKALAQHSLIMFAPRGKPVWPMVRGKEREDVTLEALCVINNNLAA
FT                   RELAADGLGIALLPHFHAAPQLAQKRLTRVLEDWERVPVSVSALFTSSRYMTPKVRAFV
FT                   DLAIVDFKNSDSNLQ"
FT                   /protein_id="YP_001521504.1"
FT   misc_feature    complement(58795..59643)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="AM1_C0055"
FT   misc_feature    complement(59464..59643)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="AM1_C0055"
FT   misc_feature    complement(58798..59379)
FT                   /note="The C-terminal substrate binding domain of LysR-type
FT                   transcriptional regulator CrgA and its related homologs,
FT                   contains the type 2 periplasmic binding domain; Region:
FT                   PBP2_CrgA_like; cd08422"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="AM1_C0055"
FT   misc_feature    complement(order(58855..58857,58936..58938,58987..58989,
FT                   59170..59172,59176..59178,59218..59220,59335..59337,
FT                   59347..59349))
FT                   /note="putative effector binding pocket; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="AM1_C0055"
FT   misc_feature    complement(order(58960..58962,58969..58974,58993..59007,
FT                   59089..59091,59272..59292,59296..59298,59308..59310,
FT                   59317..59322,59326..59331,59341..59346))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176114"
FT                   /locus_tag="AM1_C0055"
FT   gene            59946..60371
FT                   /db_xref="GeneID:5686278"
FT                   /locus_tag="AM1_C0056"
FT   CDS_pept        59946..60371
FT                   /locus_tag="AM1_C0056"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340511"
FT                   /db_xref="GeneID:5686278"
FT                   /translation="MEQTNVETVQKFFEAHYAGDFDRAFQAYAQPNFQWIVSSSSNESL
FT                   RAAIPWAGYTHQGKEGYIRLVTLLFSEFEVLTFEPSRYTDAGDRVFVEGHFTFRHRQTG
FT                   KIADSDWLARFDMEDGRITGGQFYENTVGVAEARRAA"
FT                   /protein_id="YP_001521505.1"
FT   misc_feature    59949..60365
FT                   /note="Nuclear transport factor 2 (NTF2-like) superfamily.
FT                   This family includes members of the NTF2 family,
FT                   Delta-5-3-ketosteroid isomerases, Scytalone Dehydratases,
FT                   and the beta subunit of Ring hydroxylating dioxygenases.
FT                   This family is a classic example of...; Region: NTF2_like;
FT                   cl09109"
FT                   /db_xref="CDD:175003"
FT                   /locus_tag="AM1_C0056"
FT   gene            60420..61085
FT                   /db_xref="GeneID:5686279"
FT                   /locus_tag="AM1_C0057"
FT   CDS_pept        60420..61085
FT                   /locus_tag="AM1_C0057"
FT                   /gene_family="HOG000229955" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NADP oxidoreductase, coenzyme f420-dependent"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340512"
FT                   /db_xref="GeneID:5686279"
FT                   /translation="MKIGIINAGNIGRTLAKSWHEAGHQLKLAKAGDQTKLEHFLETIG
FT                   GVKGTAREAAEFGDVALFSVYWPNLDATLAEVGDLADKIIIDTMNPLNVTEQFEHYHDL
FT                   EFMQSNSTSEELQKRLPKARVVKAFSTMPSTVLDANEWANNPVKPAVFVAGDDEQAKEV
FT                   VMQLARDAGFEPFDAGALATSRNIEQVGILLHHIGTHQFGGDYGRLAPTILQARELAA"
FT                   /protein_id="YP_001521506.1"
FT   misc_feature    60420..61001
FT                   /note="Predicted dinucleotide-binding enzymes [General
FT                   function prediction only]; Region: COG2085"
FT                   /db_xref="CDD:32268"
FT                   /locus_tag="AM1_C0057"
FT   misc_feature    60420..61001
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="AM1_C0057"
FT   gene            61171..62139
FT                   /db_xref="GeneID:5686280"
FT                   /locus_tag="AM1_C0058"
FT   CDS_pept        61171..62139
FT                   /locus_tag="AM1_C0058"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="quinone oxidoreductase/Zn-containing alcohol
FT                   dehydrogenase, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340513"
FT                   /db_xref="GeneID:5686280"
FT                   /translation="MTIQTMMRAIHMTKIGGPEVLQLAHAPRSIAQANEALIRLSYSGV
FT                   NYNDVMVRTDFFRHPGASAPELPLILGEEGAGIVEAVGSDDDNFTPGQRVGFFWDKTKT
FT                   YAEYAAVPAEKLFVLPDDISEEVAVALIHSGLTARALLYEYRPIEKDMPVLITGASGSI
FT                   GSVLVPWASQLGAKVIATVTSVAQSVGYNRVSCITTHLCRDATANEALSSMAIVLTITP
FT                   FNQILHKFSIGSNPFTVFSNMASTRSNQPYKKTQPASISTDKVFLANPAPSDLPSIVAI
FT                   KLAPPINSKYCCENASGSRTPASVANRITYCRIDSLTLIEM"
FT                   /protein_id="YP_001521507.1"
FT   misc_feature    61192..>61722
FT                   /note="Medium chain reductase/dehydrogenase
FT                   (MDR)/zinc-dependent alcohol dehydrogenase-like family;
FT                   Region: MDR; cl14614"
FT                   /db_xref="CDD:176839"
FT                   /locus_tag="AM1_C0058"
FT   misc_feature    order(61306..61314,61321..61323,61567..61569,61579..61581,
FT                   61642..61653,61657..61662,61714..61719)
FT                   /note="NAD(P) binding site; other site"
FT                   /db_xref="CDD:176178"
FT                   /locus_tag="AM1_C0058"
FT   gene            62567..63160
FT                   /db_xref="GeneID:5686281"
FT                   /locus_tag="AM1_C0059"
FT   CDS_pept        62567..63160
FT                   /locus_tag="AM1_C0059"
FT                   /gene_family="HOG000218410" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340514"
FT                   /db_xref="GeneID:5686281"
FT                   /translation="MSLNSYSCETELMDFKIYTLETAPDESKGALQQAEQTFKFIPNLE
FT                   GILAESPATLKSGMALWDLFETTSFTPIEQQVIYLTANYEHECSYCVAAHSGLAKMVGM
FT                   SAEDIEAIRNGKPLIDQKLQALRHFTKRMISERGWVGDEEIEEFLAAGYTRQQILEVIL
FT                   GIAVKVIHNYTNHIAKTPLDKAFQPYTWSKPSVP"
FT                   /protein_id="YP_001521508.1"
FT   misc_feature    62615..63118
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: COG2128"
FT                   /db_xref="CDD:32311"
FT                   /locus_tag="AM1_C0059"
FT   misc_feature    62747..>62905
FT                   /note="Carboxymuconolactone decarboxylase family; Region:
FT                   CMD; cl00460"
FT                   /db_xref="CDD:153783"
FT                   /locus_tag="AM1_C0059"
FT   gene            complement(63505..64326)
FT                   /db_xref="GeneID:5686282"
FT                   /locus_tag="AM1_C0060"
FT   CDS_pept        complement(63505..64326)
FT                   /locus_tag="AM1_C0060"
FT                   /gene_family="HOG000075379" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family
FT                   protein, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340515"
FT                   /db_xref="GeneID:5686282"
FT                   /translation="MKESMEMLAKDPNSELFSTDIEPLRIDVIGSLITAAPIDVLVNVI
FT                   LVWAKQHKSKMVCIANTHMLVDAHQKPSFGEVLKDSDIVTPNAMPLVWLLKRMGVKTQE
FT                   IVTSLNLMQCLCQKASQQKVSIFFLGSQSLILQKMRHRLAQDFPELLIAGMEPLPIRPL
FT                   TLDQRQKLIQRIKHSGAGLVMVAYSSPKQEYWMAEHKNQIEAVMIGVGGAFPAYAGLNS
FT                   SVPTWMKEIGFEWIYRFFQEPTKFWKKHVKTTSIFIHLALNQIWNRYFELR"
FT                   /protein_id="YP_001521509.1"
FT   misc_feature    complement(63583..64095)
FT                   /note="The glycosyltransferase WecG/TagA superfamily
FT                   contains Escherichia coli WecG, Bacillus subtilis TagA and
FT                   related proteins. E. coli WecG is believed to be a
FT                   UDP-N-acetyl-D-mannosaminuronic acid transferase, and is
FT                   involved in enterobacterial common...; Region:
FT                   Glyco_transf_WecG_TagA; cd06533"
FT                   /db_xref="CDD:119439"
FT                   /locus_tag="AM1_C0060"
FT   gene            65300..65512
FT                   /db_xref="GeneID:5686283"
FT                   /locus_tag="AM1_C0061"
FT   CDS_pept        65300..65512
FT                   /locus_tag="AM1_C0061"
FT                   /gene_family="HOG000232690" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340516"
FT                   /db_xref="GeneID:5686283"
FT                   /translation="MSTTISILADIPEELHETLINYLEDHPDWDQDRVFSAALSLFLMQ
FT                   YGQSDRRTARVYLDSLFKKDLPTAC"
FT                   /protein_id="YP_001521510.1"
FT   misc_feature    65315..65485
FT                   /note="Protein of unknown function (DUF2811); Region:
FT                   DUF2811; pfam10929"
FT                   /db_xref="CDD:151376"
FT                   /locus_tag="AM1_C0061"
FT   gene            65512..65946
FT                   /db_xref="GeneID:5686284"
FT                   /locus_tag="AM1_C0062"
FT   CDS_pept        65512..65946
FT                   /locus_tag="AM1_C0062"
FT                   /gene_family="HOG000022996" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340517"
FT                   /db_xref="GeneID:5686284"
FT                   /translation="MPTPQPISSLTIHLTPEHLGFLAYLYPKEDPEDALIKLLDSARTR
FT                   AIRRAEQQVRVLHLDQEQAEDQEEDPEESVSLSADVVENPIGALQELCQRQQISMPRYE
FT                   FEVIPEGFRCLVLAMGLRGVGEGRSKKQAKVMAGHCSFKK"
FT                   /protein_id="YP_001521511.1"
FT   misc_feature    65761..65922
FT                   /note="Double-stranded RNA binding motif. Binding is not
FT                   sequence specific but is highly specific for double
FT                   stranded RNA. Found in a variety of proteins including
FT                   dsRNA dependent protein kinase PKR, RNA helicases,
FT                   Drosophila staufen protein, E. coli RNase...; Region: DSRM;
FT                   cd00048"
FT                   /db_xref="CDD:28930"
FT                   /locus_tag="AM1_C0062"
FT   misc_feature    order(65761..65763,65779..65784,65893..65904,65911..65913)
FT                   /note="dsRNA binding site; other site"
FT                   /db_xref="CDD:28930"
FT                   /locus_tag="AM1_C0062"
FT   gene            66151..66363
FT                   /db_xref="GeneID:5686285"
FT                   /locus_tag="AM1_C0063"
FT   CDS_pept        66151..66363
FT                   /locus_tag="AM1_C0063"
FT                   /gene_family="HOG000023191" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340518"
FT                   /db_xref="GeneID:5686285"
FT                   /translation="MAINARTEGLGIRAAGRVLGKSPTSILLWEKRLSAQLSNFSPPSP
FT                   KEAEVTIKGDEVYTRVGKNLPPLAQ"
FT                   /protein_id="YP_001521512.1"
FT   gene            66314..66979
FT                   /db_xref="GeneID:5686286"
FT                   /locus_tag="AM1_C0064"
FT   CDS_pept        66314..66979
FT                   /locus_tag="AM1_C0064"
FT                   /gene_family="HOG000023193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340519"
FT                   /db_xref="GeneID:5686286"
FT                   /translation="MKCTPAWVKIFPPWLSEGWTIHFIDRESRYWFEARAGLKDESLFE
FT                   KSVKAAWDWAKPSSSIRWFTDGERRYSKVLWKLASAYLPRSTTTQAYPFRKIWRAGLEV
FT                   AMKLKGSQGKPRVVWVNREHPYTAISPKSDVHANHLEALHSSLRRRASSYRRRQNHYAK
FT                   TVEGLQRALNVQRLIHNWCRSHYSHGYQRTPAMVMGFIQRPVKIGEVLTVRAFECLTS"
FT                   /protein_id="YP_001521513.1"
FT   gene            67480..68097
FT                   /db_xref="GeneID:5686287"
FT                   /locus_tag="AM1_C0065"
FT   CDS_pept        67480..68097
FT                   /locus_tag="AM1_C0065"
FT                   /gene_family="HOG000022997" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340520"
FT                   /db_xref="GeneID:5686287"
FT                   /translation="MTPPIVALNPKPIPQTIPQLPKSVPSSLKLVSRTAFPKETPEGTR
FT                   PPKREQGYGELGGIRRSSRRASQTTRLKKVPHSTSSETLQVNQPRTSRESAELERRFRN
FT                   LELRQKNLVEQVSKRGELEYLAVAKNGAGRYWITVAGTGKPFMRESFATPGFCWECAVE
FT                   IEANFEILQVIELRPPETIERIEEMVQAVLERERVAESWGWG"
FT                   /protein_id="YP_001521514.1"
FT   gene            complement(68417..69148)
FT                   /db_xref="GeneID:5686288"
FT                   /locus_tag="AM1_C0066"
FT   CDS_pept        complement(68417..69148)
FT                   /locus_tag="AM1_C0066"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /transl_table="11"
FT                   /note="Upstream region overlaps with a putative
FT                   transposase."
FT                   /db_xref="GI:158340521"
FT                   /db_xref="GeneID:5686288"
FT                   /translation="MLTHWESIESQAMQENWSYAEFLLALCETEAQRREQARLKRALTE
FT                   ARLPNAKSFTNFDFSHCPQLNPAPLMQLAADPGWLERAENCLILGPSGVGKTHLATGVS
FT                   KKMLEFGKRVKFFAANALVQQLQQAKLQLQLHPMLKKLDRYDLLILDDLGYCKKSEAET
FT                   SVLFELIAHRYERKSLLITANQPFSQWDDIFTDSMMAVAAIDRLIHHGLIIEIQADSYR
FT                   RKSATQRTAQTQSPPQKSQSK"
FT                   /protein_id="YP_001521515.1"
FT   misc_feature    complement(68507..69043)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="AM1_C0066"
FT   gene            complement(68976..70712)
FT                   /db_xref="GeneID:5686289"
FT                   /locus_tag="AM1_C0067"
FT   CDS_pept        complement(68976..70712)
FT                   /locus_tag="AM1_C0067"
FT                   /gene_family="HOG000139033" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase, putative"
FT                   /transl_table="11"
FT                   /note="Downstream region overlaps with a putative
FT                   transposase-associated ATP-binding protein."
FT                   /db_xref="GI:158340522"
FT                   /db_xref="GeneID:5686289"
FT                   /translation="MPNKRIDSYHTRVYMNGRDLGLKQADAAYIAEISTRTGQRIEAGT
FT                   HQPNRGRLQDQRTVPDPLADVWEDELEPMLRRDPRLKPMTLYEYLQDKYPGQYPQVLRT
FT                   LQRRVRTWKALHGPSPEVMFELRHEPGVQGFSDFTELKGITITIAGKPFEHLIYHYRLG
FT                   YSGWRYAQIIQGGESFVALSEGLQNAFAACGGVPTQHRTDSLSAAYRNMGGRRSKNLTR
FT                   LYDELCDHYRLEPTRNNKGVAHENGSIESPHGHLKNRIKQAIYLRGSADFTSVAEYQAL
FT                   IDAQVAKLNQQCQTKYEQEKDHLQPLPKYRTPDYEVLTAKVSKRSTIDVRCILYTVPSR
FT                   LIGRQLELHLYHDRIVGYLERHPVVELPRKRVSGKGKRRDRCINYRHVIGSMRLKPRAF
FT                   IYCTWQSDLLPNPEYRQIWEQLKAQFDLEQAAKIIVEALYIAAVQDKEQAVAVYLQQQL
FT                   RSSSLTLNRLKKQFEPPQMKQVPELSIEQHSLELYDKLLPSCSVPAEPLPAPEPLFKKA
FT                   QALPHVDPLGIYRIPSHAGKLVLCGILTSLVRNGGPTKRTSSSKTCPHRSQAPKRKKFY
FT                   QL"
FT                   /protein_id="YP_001521516.1"
FT   misc_feature    complement(69933..70334)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="AM1_C0067"
FT   gene            71092..71457
FT                   /db_xref="GeneID:5686290"
FT                   /locus_tag="AM1_C0068"
FT   CDS_pept        71092..71457
FT                   /locus_tag="AM1_C0068"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340523"
FT                   /db_xref="GeneID:5686290"
FT                   /translation="MPPIPIRWVLIRDPQGRCKPQALLCTDLEISSIKMMQWFRQGWQV
FT                   EVTFEEVRAHLGVETQRQWSDQAILRTTPALLALFSIVTALAHQLQSTHPVACPMTAWY
FT                   RKLNPSFADALAQVRRH"
FT                   /protein_id="YP_001521517.1"
FT   gene            complement(71578..71691)
FT                   /db_xref="GeneID:5686291"
FT                   /locus_tag="AM1_C0069"
FT   CDS_pept        complement(71578..71691)
FT                   /locus_tag="AM1_C0069"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340524"
FT                   /db_xref="GeneID:5686291"
FT                   /translation="MSSNEAALRVTVDEMNPYPSFPDGQSAQQGPTKSTTS"
FT                   /protein_id="YP_001521518.1"
FT   gene            71699..71833
FT                   /db_xref="GeneID:5686292"
FT                   /locus_tag="AM1_C0070"
FT   CDS_pept        71699..71833
FT                   /locus_tag="AM1_C0070"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340525"
FT                   /db_xref="GeneID:5686292"
FT                   /translation="MQWKAHTQQPRLLMSLAFINTPPLMDGSRPQRQQVMVFCLFIGA"
FT                   /protein_id="YP_001521519.1"
FT   gene            complement(72074..72199)
FT                   /db_xref="GeneID:5686293"
FT                   /locus_tag="AM1_C0071"
FT   CDS_pept        complement(72074..72199)
FT                   /locus_tag="AM1_C0071"
FT                   /gene_family="HOG000022982" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340526"
FT                   /db_xref="GeneID:5686293"
FT                   /translation="MKSTTPLQADGVWNTICSQTVDLDCNPISSLQAAGNLPPLD"
FT                   /protein_id="YP_001521520.1"
FT   gene            complement(72313..72459)
FT                   /db_xref="GeneID:5686294"
FT                   /locus_tag="AM1_C0072"
FT   CDS_pept        complement(72313..72459)
FT                   /locus_tag="AM1_C0072"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340527"
FT                   /db_xref="GeneID:5686294"
FT                   /translation="MHFNAPVSSLLVAFDAHPLNRFAIWMEISDSSTLVSGQKVWVNQT
FT                   NRE"
FT                   /protein_id="YP_001521521.1"
FT   gene            complement(72416..72661)
FT                   /db_xref="GeneID:5686295"
FT                   /locus_tag="AM1_C0073"
FT   CDS_pept        complement(72416..72661)
FT                   /locus_tag="AM1_C0073"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340528"
FT                   /db_xref="GeneID:5686295"
FT                   /translation="MPDSSNQLKKSCQNCIHLQKLNLSKIVWDGTFLPSYGCGIKGIEN
FT                   HWPDLQAVIVATHLDPQTKAEMIALQCPRFKFVGSL"
FT                   /protein_id="YP_001521522.1"
FT   gene            complement(72752..73027)
FT                   /db_xref="GeneID:5686296"
FT                   /locus_tag="AM1_C0074"
FT   CDS_pept        complement(72752..73027)
FT                   /locus_tag="AM1_C0074"
FT                   /gene_family="HOG000276232" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340529"
FT                   /db_xref="GeneID:5686296"
FT                   /translation="MSIYVGNLSYEVAQEDLRAIFSEYGEVTNVHLPKDRETGKLRGFA
FT                   FVDLGNDADEVKAIEDLDGAEWMGRSLKVNKARPREKNRGSSRKRE"
FT                   /protein_id="YP_001521523.1"
FT   misc_feature    complement(72800..73024)
FT                   /note="RRM (RNA recognition motif), also known as RBD (RNA
FT                   binding domain) or RNP (ribonucleoprotein domain), is a
FT                   highly abundant domain in eukaryotes found in proteins
FT                   involved in post-transcriptional gene expression processes
FT                   including mRNA and rRNA...; Region: RRM; cd00590"
FT                   /db_xref="CDD:100104"
FT                   /locus_tag="AM1_C0074"
FT   misc_feature    complement(order(72890..72892,72896..72898,73016..73018))
FT                   /note="RNA/DNA binding site; other site"
FT                   /db_xref="CDD:100104"
FT                   /locus_tag="AM1_C0074"
FT   misc_feature    complement(72800..72808)
FT                   /note="RRM dimerization site; other site"
FT                   /db_xref="CDD:100104"
FT                   /locus_tag="AM1_C0074"
FT   gene            complement(73270..74019)
FT                   /db_xref="GeneID:5686297"
FT                   /locus_tag="AM1_C0075"
FT   CDS_pept        complement(73270..74019)
FT                   /locus_tag="AM1_C0075"
FT                   /gene_family="HOG000287552" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340530"
FT                   /db_xref="GeneID:5686297"
FT                   /translation="MINPGQAGVVSILGKARDVAFLEGIHFKPPLISAVDVYDVTVQKF
FT                   EVPAQSSTKDLQDLNARFAINFRLDPIQVVEIRRTQGSLENIVTKIIAPQTQESFKIAA
FT                   SRKTVEEAITQRTELKQDFDDVLGARLDKYGIIVLDTSVVDLEFSPEFAKSVEDKQIAE
FT                   QRAKRAIYVAQEAEQEAQAEINRARGKAEAQRLLAETLKAQGGELVLQKEAIQAWREGG
FT                   SQVPEVLVNGGSEQSGVPFLFNIKDAH"
FT                   /protein_id="YP_001521524.1"
FT   misc_feature    complement(73438..74016)
FT                   /note="The band 7 domain of flotillin (reggie) like
FT                   proteins. This group contains proteins similar to stomatin,
FT                   prohibitin, flotillin, HlfK/C and podicin.  Many of these
FT                   band 7 domain-containing proteins are lipid
FT                   raft-associated.  Individual proteins of this...; Region:
FT                   Band_7; cl02525"
FT                   /db_xref="CDD:164020"
FT                   /locus_tag="AM1_C0075"
FT   gene            complement(74220..75284)
FT                   /db_xref="GeneID:5686298"
FT                   /locus_tag="AM1_C0076"
FT   CDS_pept        complement(74220..75284)
FT                   /locus_tag="AM1_C0076"
FT                   /gene_family="HOG000023001" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340531"
FT                   /db_xref="GeneID:5686298"
FT                   /translation="MTQYSELKSALQPHLNWHGARLSFLTLFLLALFKVKTVNLSELAL
FT                   GFEGSAQSDSKYKRLQRFFRGFDLEYATIAKLVIDWMQTPQPWVLSIDRTTWEFGTHCF
FT                   NILSIGVVHEGVAFPLLWWMLQKKGNSSSDERMRFVEALLHICPDLQIRYLCGDREFIG
FT                   QLWVRYLRLAPLLPFRLRIRATDKIERQGKALQTKVVFAHLQVGQRQRLKGDCRVWGQP
FT                   VAVEGLRLEDGALLVVIGPTQDDQLIDDYALRWGIETLFGIFKTRGFCLESTHFTEAER
FT                   LRKLFALLTLALYWAMKTGLFLHQLKPIALKTHERRAKSLFRLGFDHFRQMILNPSPGN
FT                   EREFLQSLQLLSST"
FT                   /protein_id="YP_001521525.1"
FT   gene            complement(75338..75811)
FT                   /db_xref="GeneID:5686299"
FT                   /locus_tag="AM1_C0077"
FT   CDS_pept        complement(75338..75811)
FT                   /locus_tag="AM1_C0077"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="1A family penicillin-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340532"
FT                   /db_xref="GeneID:5686299"
FT                   /translation="MQLTTSVYVIVTQLRGSLQASAYATFANNGWQSKTTAILQVTDRS
FT                   GKALIDNPPQPKLVLNQWAVASVNSTLQTVVQSGTGIAAQIGRPAAGKTGTTSSERDVW
FT                   FVGYVPQLSVAVWEGNDNYARIGAGATGGGWMAPVWREFMSEALKDLSTGQKA"
FT                   /protein_id="YP_001521526.1"
FT   misc_feature    complement(75380..>75757)
FT                   /note="Penicillin binding protein transpeptidase domain;
FT                   Region: Transpeptidase; cl01039"
FT                   /db_xref="CDD:154162"
FT                   /locus_tag="AM1_C0077"
FT   gene            75949..77679
FT                   /db_xref="GeneID:5686300"
FT                   /locus_tag="AM1_C0078"
FT   CDS_pept        75949..77679
FT                   /locus_tag="AM1_C0078"
FT                   /gene_family="HOG000139033" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase, putative"
FT                   /transl_table="11"
FT                   /note="Downstream region overlaps with a putative
FT                   transposase-associated ATP-binding protein."
FT                   /db_xref="GI:158340533"
FT                   /db_xref="GeneID:5686300"
FT                   /translation="MPAPIKPQQVHLYMQTKQSGSSQETAAAKAGISTRTAHRIDSGTH
FT                   RPQRGRPHDWKTREDPLDGLWELELEPMLEREPRLEATTLFETLQENHPGQYDDKIRTV
FT                   QRRTAKWKAAHGKPKEVMFKIQHHPGEMGQSDFAQLKGFSVTVQGEAFHHILYHYRLSY
FT                   SGWQYVQVIQGGESFIGLSQGLQNALTACGGVPKIHRTDSLSAAYRNTGGRNPQLTQLY
FT                   STLCDHYRMQPTRNNLGVSHENGGIEGSHGYFKRRLCQALYRRGSFDFDSVAEYQQFIE
FT                   QVIAKLNAKCQKKFALELPTLQPLPRYRTPDYEVRSAKVSCNSTIAVRCVLYTVPSRLI
FT                   GHRLKLHLYHDRLVGFLGTTPVVELARVHVHGSEKKRRARSIDYKHVAESLRRKPNAFL
FT                   YCQWQSELLPNLQWHQLWESLKANFEQDQAARLITEALYIAATQDQESQVADYLQTQLE
FT                   QSTLTLSRLKQAFEFKLSTEQYPDVTSQQHDLSDYDQLLHSRPGQPIPVADDNPKTVAV
FT                   EAFPRRVAEHRASSDSGELVLRPVSVGFSSRRSQPSGAESDFTRSNRSAAALRKVLDQF
FT                   "
FT                   /protein_id="YP_001521527.1"
FT   misc_feature    76321..76722
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="AM1_C0078"
FT   gene            77468..78223
FT                   /db_xref="GeneID:5686301"
FT                   /locus_tag="AM1_C0079"
FT   CDS_pept        77468..78223
FT                   /locus_tag="AM1_C0079"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /transl_table="11"
FT                   /note="Upstream region overlaps with a putative
FT                   transposase."
FT                   /db_xref="GI:158340534"
FT                   /db_xref="GeneID:5686301"
FT                   /translation="MLMTTLKQLRLRHFLDEWQSIEHQATQENWSYAQFLLALAQGEAS
FT                   RREQNRISRALTEAQLPYGKSWTNFEFAHVPTLNPAALMEFAQTTHWLESGSNILIFGP
FT                   SGTGKTHVSSALGASIIELGKRVKFVTATTLVQQLQLAKLQLELQSLLSKLDRYDLLII
FT                   DDLGYVQKSDVETSVLFELIAHRYERKSLLITANQPFSQWDSIFPNSMMTVAAIDRLIH
FT                   HATIFEMQAESFRKQEAAKHTAKSQKTDS"
FT                   /protein_id="YP_001521528.1"
FT   misc_feature    77483..78175
FT                   /note="DNA replication protein [DNA replication,
FT                   recombination, and repair]; Region: DnaC; COG1484"
FT                   /db_xref="CDD:31673"
FT                   /locus_tag="AM1_C0079"
FT   misc_feature    77612..78148
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="AM1_C0079"
FT   gene            complement(78542..79390)
FT                   /db_xref="GeneID:5686302"
FT                   /locus_tag="AM1_C0080"
FT   CDS_pept        complement(78542..79390)
FT                   /locus_tag="AM1_C0080"
FT                   /gene_family="HOG000023132" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase, catalytic region"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340535"
FT                   /db_xref="GeneID:5686302"
FT                   /translation="MVNQLKEHYPIQMICNVIGYSRSRYYYHQNPGKENRKEVILKSAI
FT                   ADVAGRYPTHGYRRITQQLRREGHTVNHKRVSRLMRGMGLLAKQRVQRKRTTNSVHGYK
FT                   RYPNLVKALTMVRPNQVWVADITYIRLREEFVYLAVLMDVFTRGIRGWHLDWTMEKSLT
FT                   ITALEKALLGHTPEIHHSDQGVQYAANDYVKMLEDNDVKISMAAVGKAYENGFAERLMR
FT                   TIKEEEVDLSEYRNFREVNERIEMFLEEVYMKKRIHSSLSYLTPSEFEEKWRYEQENIQ
FT                   M"
FT                   /protein_id="YP_001521529.1"
FT   misc_feature    complement(78545..79339)
FT                   /note="putative transposase OrfB; Reviewed; Region:
FT                   PHA02517"
FT                   /db_xref="CDD:164923"
FT                   /locus_tag="AM1_C0080"
FT   misc_feature    complement(78710..79042)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="AM1_C0080"
FT   gene            complement(79384..79644)
FT                   /db_xref="GeneID:5686303"
FT                   /locus_tag="AM1_C0081"
FT   CDS_pept        complement(79384..79644)
FT                   /locus_tag="AM1_C0081"
FT                   /gene_family="HOG000266649" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340536"
FT                   /db_xref="GeneID:5686303"
FT                   /translation="MVLEVVSGQRTPTETCRAHKIHMSVLSRWRNEFLKQAYRAFGTQE
FT                   VNDKASERIAELERMIGRLTMELEVAKKASDMWNLNENMKW"
FT                   /protein_id="YP_001521530.1"
FT   gene            complement(79664..81252)
FT                   /note="penicillin-binding protein, putative"
FT                   /db_xref="GeneID:5686304"
FT                   /locus_tag="AM1_C0082"
FT                   /pseudo
FT   gene            complement(81706..81828)
FT                   /db_xref="GeneID:5686305"
FT                   /locus_tag="AM1_C0084"
FT   CDS_pept        complement(81706..81828)
FT                   /locus_tag="AM1_C0084"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340537"
FT                   /db_xref="GeneID:5686305"
FT                   /translation="MNFWADLWGGKDFFADHVVTSQALVKEPVISADLEGFWGR"
FT                   /protein_id="YP_001521531.1"
FT   gene            complement(81825..82574)
FT                   /db_xref="GeneID:5686306"
FT                   /locus_tag="AM1_C0085"