(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE1

ACAM1_4.PE1          Location/Qualifiers
FT   CDS_pept        join(272785..273121,1..323)
FT                   /locus_tag="AM1_C0001"
FT                   /gene_family="HOG000135602" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340456"
FT                   /db_xref="GeneID:5686041"
FT                   /translation="MGALGTELTSYSKNESQAKPVKEWGSVVTAYTIDFSPITKLTDEQ
FT                   FDLLCEANPEIKFERTPTGELVIMPPTGGETGRGNAKLTSRFVVWSERYGLGEVFDSST
FT                   CFRIPSGGDRSPDVAWVEKSRWDALTPEQQRKFPPICPDFVLELLSPSDNLTATQRKMQ
FT                   EYLTSGIRLGWLINPEDKQVEIYRPGQEVEVLQSPSSVSGEEVLLEFSLNLEWIWR"
FT                   /protein_id="YP_001521450.1"
     GTGGGAGCTT TAGGAACTGA GTTAACAAGC TACAGTAAGA ATGAATCTCA AGCTAAGCCC        60
     GTCAAGGAAT GGGGAAGTGT AGTGACAGCT TATACCATTG ACTTCAGCCC AATTACCAAA       120
     CTCACAGATG AGCAGTTTGA CCTTCTCTGT GAGGCCAATC CTGAAATTAA GTTTGAGCGC       180
     ACCCCAACTG GAGAACTTGT CATTATGCCG CCAACTGGTG GGGAAACGGG TCGAGGTAAT       240
     GCAAAACTTA CCTCCCGATT CGTTGTTTGG AGCGAACGAT ATGGCCTTGG TGAAGTCTTT       300
     GATTCATCCA CCTGTTTCAG AATTCCTAGT GGTGGTGATC GGTCCCCTGA TGTGGCCTGG       360
     GTAGAAAAGT CCCGCTGGGA TGCCCTCACA CCAGAACAAC AGCGCAAATT CCCGCCAATC       420
     TGCCCTGACT TCGTACTGGA ATTGCTCTCA CCCAGCGATA ACCTCACCGC CACTCAGCGA       480
     AAAATGCAGG AGTATCTAAC CAGTGGAATA CGACTAGGAT GGCTTATCAA CCCAGAAGAC       540
     AAACAGGTGG AGATTTATCG ACCAGGGCAG GAAGTCGAAG TACTACAATC TCCCAGCTCG       600
     GTTTCTGGAG AAGAGGTGCT GCTAGAGTTT AGCCTCAATC TGGAGTGGAT TTGGAGGTAG       660
//

If you have problems or comments...

PBIL Back to PBIL home page