(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE10

ACAM1_4.PE10         Location/Qualifiers
FT   CDS_pept        complement(4853..5197)
FT                   /locus_tag="AM1_C0010"
FT                   /gene_family="HOG000269309" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340465"
FT                   /db_xref="GeneID:5686232"
FT                   /translation="MATIEATYASTIAQLNDEFRQGNHSLGRIFTTPGVDALSSEDQQE
FT                   LFRLVRTFDEFTEDNDPRGERDFGFIKFKGEVFNFKIDYYAPDMIHGSEDPEDLTITTR
FT                   VLTLMHSSEY"
FT                   /protein_id="YP_001521459.1"
     atggcaacta tcgaagcgac ctacgcatcc accatcgccc aactcaatga cgaatttcgc        60
     caaggcaatc attctctcgg tcgaatcttc acgacccctg gggttgacgc cctttcctcc       120
     gaagatcagc aagaactctt ccgacttgtt cgcacgttcg atgaatttac tgaggataat       180
     gacccaaggg gagagcgtga ttttgggttc atcaaattta agggcgaagt ctttaacttc       240
     aagattgatt actatgcccc ggatatgatt catggttcgg aagacccaga ggatttgacg       300
     attacaacca gggttctaac cctcatgcac tccagcgagt attag                       345
//

If you have problems or comments...

PBIL Back to PBIL home page