(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE11

ACAM1_4.PE11         Location/Qualifiers
FT   CDS_pept        complement(5263..5556)
FT                   /locus_tag="AM1_C0011"
FT                   /gene_family="HOG000022980" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340466"
FT                   /db_xref="GeneID:5686233"
FT                   /translation="MNTTLTQMEQWIDERVTDPLHPEYFLLYAQVEFWPGVREGGALEE
FT                   YYIIIKNRVGSVGDRLRDWVLKRFGVSARLADWETIPSLRQLRAESQYEDEF"
FT                   /protein_id="YP_001521460.1"
     atgaacacta ctctaacgca aatggagcag tggatcgacg aacgagtcac agatccgctt        60
     caccctgaat atttcttgct gtacgcccag gtcgagtttt ggcctggtgt ccgggaaggg       120
     ggagccttgg aagagtatta catcatcatc aagaaccgtg ttggttcagt tggtgatcgg       180
     ctccgagatt gggtcttgaa gcgattcggc gtgtctgccc gacttgcaga ctgggaaact       240
     atcccctcac tccgacaact tcgggctgaa tctcagtacg aagacgagtt ttag             294
//

If you have problems or comments...

PBIL Back to PBIL home page