(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE12

ACAM1_4.PE12         Location/Qualifiers
FT   CDS_pept        5909..6154
FT                   /locus_tag="AM1_C0012"
FT                   /gene_family="HOG000225389" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="helix-turn-helix domain-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340467"
FT                   /db_xref="GeneID:5686234"
FT                   /translation="MLTLLELVENLELSFSQWFLLMRRKQGLTQDDIAEALGISGQSVS
FT                   NWERGRSIPTLTIDQVKTLCKILDCTLNDIPSSDTE"
FT                   /protein_id="YP_001521461.1"
     ATGCTGACTC TGTTGGAGTT GGTCGAGAAT TTGGAACTCA GTTTCAGTCA ATGGTTTTTG        60
     CTAATGCGTC GGAAGCAGGG GTTAACTCAG GACGATATAG CTGAAGCACT TGGCATTAGC       120
     GGTCAGTCAG TTAGTAATTG GGAGAGAGGC CGTTCTATTC CAACACTGAC GATTGATCAG       180
     GTAAAAACCT TATGCAAAAT CCTCGACTGT ACCCTTAATG ACATCCCTAG TTCTGATACT       240
     GAATGA                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page