(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE13

ACAM1_4.PE13         Location/Qualifiers
FT   CDS_pept        6861..10283
FT                   /locus_tag="AM1_C0013"
FT                   /gene_family="HOG000023186" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340468"
FT                   /db_xref="GeneID:5686235"
FT                   /translation="MTLSGQIEGYRYLGQSKDGLWGKYVLDDGKDLSQEDRERRWQEQR
FT                   ILREQRAQAEAQRHAQSLPASERDQHYRQLLDQLTLHPADRADLHRRGFTNEQIQDWGV
FT                   KSVEQWQSLSSELPHTLPGVGLDGQSLITPRPGYLCSIVDAEDLIVGFQVRARTSEGGR
FT                   YYWLTGKTRKRPTGPTPHLPTGELPLAVHRPEQITRDAIALVEGTGAKPHLLAQRLGQV
FT                   TIGAAGGLFAASPATLKASLAQLGANTIEFYPDAGAIQNKSVLRQYRATWKLLKDWGYT
FT                   VTVAWWKQTDKRIHTDIDELDDFSQIQYLSVAEFERIAAQCNGLLHQLQQALSKLTRPS
FT                   SPVQGFATPNDQQTHPPNPRGTKRTAPDDKRLATLPATSRRAKRSRRRTARLLTAHRRH
FT                   GYISKLRLENYRRRIRRHTSRATHSRCSSLQSRPGDNGTLETTTPLVHEYEPGQRLQTW
FT                   QTLISSGFPYILDQSQPGTGKSYDSGNVTPIGFGVEQVIYLSDQHRNPTVSTLEQGNGW
FT                   CDLEARHGGLNRVKNRLQRSAKGDAFAVPANCSRIGVLNALRDKNIPGADTANLICGTC
FT                   VAREACINANGPGYGFLNQRRNVLGVPLLRAHPDSLPDPEDYPLENTMLIWDEPGQNFQ
FT                   VKQSVTVTFTDLQQTISGLITYPEIFALVQPLLSALLPLMDGSEKLGKFGLNHLAVKGR
FT                   LPDMTGVKLGEIALILMPNLGFLNTTSDYGIDLADLPKQLRKKFSERDSEMAEQARNGV
FT                   VKQWLVPLIRILQGGAGCIQVSRYGLLTLNTPNPRHRDLAQAAQANVFLDATLSREDLA
FT                   LKLGCSPDEILVVRQAVPDTGNLEVIQVTDMGRVGMSRGGDQTKRIDALVKHYQELDAA
FT                   STKTIDFKKFEKDGAWWRDSRGVNDFLNVQTLILVGTPCRNLNDLAAEFAMVCGHYPDE
FT                   EESAFKAFVDRSILAEIHQAIGRLRAHRRPGESLQVVLISNIEMDCPVDRVQAKELTLD
FT                   AAHKAERVRLAIESAILQLQAKGKKVTQQVVSAMTQIPRGTIARYWRLFISLLEGLNSR
FT                   MNNSKKVLEADQDCHQAIAGVLDELSELPVNDLLPSLNEVFFDWLKPREWANVWDKVNA
FT                   SSQMAILEGIAMVLPLKMLDQALSEIEMQFQIC"
FT                   /protein_id="YP_001521462.1"
     ATGACCCTCT CAGGCCAGAT CGAGGGATAT CGCTACCTCG GTCAATCCAA AGATGGCCTC        60
     TGGGGTAAAT ACGTCCTCGA TGACGGGAAA GACCTCAGCC AGGAAGACCG GGAACGCCGA       120
     TGGCAAGAGC AACGCATTCT CAGAGAGCAA CGTGCCCAAG CGGAGGCCCA ACGCCATGCC       180
     CAATCGCTCC CCGCATCAGA ACGAGACCAG CATTATCGCC AACTTCTTGA CCAGCTCACC       240
     CTTCACCCAG CAGATCGGGC AGACTTGCAT CGTCGAGGAT TCACCAATGA GCAGATCCAA       300
     GACTGGGGAG TGAAGTCGGT CGAGCAGTGG CAATCCCTCT CTAGTGAACT GCCTCATACC       360
     CTGCCAGGAG TAGGCTTAGA CGGTCAATCC TTGATTACTC CAAGACCAGG TTATCTTTGC       420
     TCCATCGTTG ATGCAGAGGA CCTTATCGTT GGGTTCCAAG TCAGAGCAAG AACCTCCGAG       480
     GGTGGCCGCT ATTACTGGCT CACAGGCAAA ACCAGAAAAC GACCCACTGG ACCCACACCC       540
     CACCTTCCCA CTGGCGAGTT ACCCCTCGCC GTCCATCGTC CAGAGCAAAT CACAAGAGAT       600
     GCAATCGCAC TCGTTGAAGG CACAGGGGCT AAACCTCACC TCCTTGCTCA AAGGCTAGGC       660
     CAAGTGACCA TCGGTGCAGC TGGGGGATTA TTCGCGGCAT CTCCTGCAAC CCTGAAGGCA       720
     TCACTCGCTC AGCTCGGAGC TAATACGATT GAGTTCTACC CTGATGCTGG GGCCATTCAG       780
     AACAAATCTG TTCTACGACA GTATCGAGCG ACATGGAAAC TTCTGAAGGA CTGGGGTTAC       840
     ACTGTCACCG TTGCCTGGTG GAAGCAGACG GACAAACGCA TCCACACTGA CATTGATGAA       900
     CTGGATGATT TTAGCCAAAT TCAGTATTTG TCCGTGGCTG AGTTTGAACG GATTGCAGCT       960
     CAATGTAATG GGCTATTGCA TCAGCTTCAG CAGGCACTCT CAAAACTCAC TCGTCCTTCA      1020
     TCGCCCGTTC AAGGGTTTGC CACTCCCAAT GACCAACAAA CCCACCCCCC TAACCCTCGC      1080
     GGAACGAAGC GAACTGCACC AGATGACAAG CGTCTTGCAA CGCTGCCTGC AACAAGCCGT      1140
     CGAGCTAAAC GATCCCGTCG CCGCACTGCA CGACTCCTTA CAGCTCATCG AAGACATGGA      1200
     TATATTTCAA AACTTCGACT GGAAAACTAT CGAAGACGCA TTAGAAGACA TACTTCAAGA      1260
     GCGACACACT CCAGATGTAG CAGCTTACAA AGCCGCCCTG GAGATAACGG GACTCTCGAA      1320
     ACAACAACAC CTCTAGTCCA TGAATACGAG CCGGGTCAGC GACTCCAGAC CTGGCAAACC      1380
     CTCATCTCAT CAGGATTCCC CTACATCCTT GACCAGTCCC AACCCGGTAC TGGGAAAAGC      1440
     TACGACTCTG GGAACGTTAC CCCGATTGGC TTTGGAGTTG AACAGGTCAT CTACTTGAGT      1500
     GACCAGCACC GCAATCCTAC CGTATCAACA TTAGAACAAG GAAATGGCTG GTGTGACCTA      1560
     GAAGCACGGC ATGGAGGACT CAATCGGGTC AAGAATCGGC TCCAACGATC TGCCAAAGGT      1620
     GATGCCTTCG CTGTTCCCGC TAACTGTAGT CGCATTGGAG TGTTGAATGC TCTACGGGAT      1680
     AAGAATATCC CTGGTGCCGA TACCGCCAAC CTCATCTGCG GCACCTGTGT TGCTCGGGAA      1740
     GCCTGCATCA ATGCCAATGG GCCAGGATAC GGGTTCCTGA ATCAACGGCG CAATGTCCTG      1800
     GGTGTCCCAC TGTTGAGGGC ACATCCTGAC TCATTGCCTG ATCCAGAGGA TTACCCCCTG      1860
     GAAAACACCA TGCTGATCTG GGATGAGCCA GGGCAAAACT TCCAGGTCAA GCAGTCCGTG      1920
     ACTGTCACCT TCACCGACCT ACAGCAAACC ATTTCAGGTC TGATTACCTA TCCTGAAATC      1980
     TTTGCCTTGG TGCAGCCCTT ACTCTCAGCA CTTCTGCCCT TAATGGATGG GTCTGAGAAG      2040
     CTAGGAAAGT TTGGCTTGAA TCACTTAGCC GTCAAAGGCC GTCTGCCCGA CATGACCGGG      2100
     GTAAAGCTGG GAGAAATCGC CCTAATTCTG ATGCCAAACC TGGGATTCCT CAATACCACT      2160
     TCCGACTATG GGATTGACCT CGCAGATTTA CCCAAGCAAC TGAGAAAGAA GTTCTCTGAG      2220
     CGAGACTCGG AGATGGCCGA GCAAGCTCGG AATGGAGTGG TCAAGCAGTG GCTCGTCCCC      2280
     TTAATCCGCA TCTTGCAGGG TGGAGCAGGA TGTATCCAAG TTAGCCGCTA TGGCCTACTG      2340
     ACCCTCAATA CCCCCAACCC TCGCCATCGG GACTTAGCTC AAGCTGCCCA AGCCAATGTG      2400
     TTTCTCGACG CTACACTCTC CCGTGAAGAC CTAGCGCTGA AGTTGGGCTG CTCTCCTGAT      2460
     GAAATCTTAG TGGTGCGCCA AGCTGTCCCA GACACCGGAA ACCTGGAGGT GATTCAGGTG      2520
     ACCGACATGG GGCGCGTGGG CATGAGTCGA GGTGGGGATC AGACCAAGCG CATTGATGCC      2580
     CTGGTAAAGC ATTACCAGGA ATTGGATGCA GCCTCCACCA AAACTATCGA CTTCAAGAAG      2640
     TTTGAAAAGG ATGGGGCCTG GTGGCGAGAC AGCCGAGGGG TCAATGATTT CCTGAACGTG      2700
     CAGACCCTCA TCCTCGTGGG CACTCCCTGT CGCAATCTTA ATGATTTGGC CGCCGAGTTT      2760
     GCAATGGTTT GCGGGCATTA CCCAGATGAA GAAGAATCAG CGTTCAAAGC CTTCGTAGAC      2820
     CGCTCCATCC TTGCAGAGAT TCACCAAGCG ATTGGACGAC TCAGGGCACA TCGACGCCCT      2880
     GGAGAATCCC TGCAAGTGGT GTTGATTTCA AATATTGAGA TGGATTGCCC TGTTGACAGA      2940
     GTCCAGGCCA AGGAACTCAC CCTAGATGCC GCCCACAAAG CAGAGCGGGT GAGACTTGCG      3000
     ATTGAGTCAG CCATCCTTCA GTTGCAAGCC AAGGGTAAGA AGGTCACTCA ACAAGTGGTG      3060
     TCGGCAATGA CCCAAATCCC AAGAGGGACG ATTGCCCGGT ACTGGCGTCT GTTCATTTCG      3120
     CTATTAGAAG GTTTAAATAG CAGAATGAAC AATTCTAAGA AAGTATTAGA AGCAGACCAG      3180
     GATTGCCATC AAGCGATTGC GGGTGTTCTA GACGAGCTGT CGGAGCTGCC AGTTAATGAT      3240
     CTCTTGCCCA GTCTGAATGA AGTGTTCTTT GACTGGCTTA AACCCAGAGA ATGGGCCAAC      3300
     GTCTGGGACA AAGTGAACGC ATCCAGTCAG ATGGCGATTC TGGAGGGGAT TGCAATGGTG      3360
     TTACCCTTGA AGATGTTGGA CCAAGCGTTG TCAGAAATTG AGATGCAATT CCAGATTTGT      3420
     TGA                                                                    3423
//

If you have problems or comments...

PBIL Back to PBIL home page