(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE15

ACAM1_4.PE15         Location/Qualifiers
FT   CDS_pept        complement(13046..14269)
FT                   /locus_tag="AM1_C0015"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340470"
FT                   /db_xref="GeneID:5686237"
FT                   /translation="MGLAVIHWITLKPLGWPLNVQLPLLSRLPMKVSLFLGFNHHRLPM
FT                   KCKTITSWLGVMVVGLIIQACNQHSGGGTVSVDPTLFYEDALVGDIAEELCTLSGGTET
FT                   ICYRITVKSTPVDHQAVPWCPETISDGDKAGGIWPDGGKINNVDGAFIKNLEAFYSDDQ
FT                   WKLYRDDGSVRVTDSKEACVAARPNVDEDYQNFCVQCLLSYLEKGMVNTHIIPIKPVQQ
FT                   TKPRQIARTSGGLALNGVNFDPPAPTNAILSARTLTPFDDCGGHIHLNHGYHYHAHTGC
FT                   LTEVAQEDTHSLMIGHALEGFSLHARLEEQSAEESSLDECRGHSNETRGYHYHVTDPGS
FT                   NSFINCFQRSMGARLKEMGKGRPVMPHQQTIEGDRVAPLVRVRENPEDRMMKQSKNLIV
FT                   HNLIYNLA"
FT                   /protein_id="YP_001521464.1"
     atgggccttg ccgttatcca ttggataact ctgaaaccct tagggtggcc ccttaatgtc        60
     caattacctt tattgtccag attacccatg aaagtatcgc tatttctggg gtttaatcac       120
     catagacttc ccatgaagtg taagaccata acatcttggc tgggtgtaat ggtggttggc       180
     ttgatcatcc aagcttgtaa tcagcacagt gggggaggga ctgtaagtgt cgatcccact       240
     ctattttatg aagatgcctt agtaggtgat attgcagagg aattgtgtac gctgtcagga       300
     ggaacagaaa caatctgtta ccgcatcacc gttaaatcca ctccggtgga tcatcaagca       360
     gtgccatggt gcccagaaac tattagtgat ggagataaag ctggcggaat ctggccagac       420
     ggcggcaaaa ttaataatgt tgatggcgct tttatcaaaa atctggaggc tttttacagc       480
     gacgatcaat ggaaactcta tcgagacgat ggctccgttc gagtcacgga ttcaaaagag       540
     gcctgcgttg ctgctcgtcc aaatgttgat gaagactacc aaaatttctg tgtgcagtgc       600
     ttactgtcct atttagagaa aggcatggtt aacactcaca tcatcccgat caagcctgtt       660
     cagcaaacaa aaccgaggca aatcgctcgc acatctgggg gtttagcgct caatggggta       720
     aattttgatc cccccgcacc gacaaatgca attttgagtg cccgtacact caccccattt       780
     gacgactgcg gtggtcatat ccatcttaat catggctatc actaccatgc ccatacgggc       840
     tgcctaactg aggtagcaca ggaagatacg catagtctca tgattggcca tgctctcgaa       900
     gggttctcac ttcacgctcg attggaggag caaagcgcag aggagagcag cttagatgag       960
     tgccggggtc attctaatga aactcgtggc tatcactatc atgtcaccga ccctggtagt      1020
     aactccttta tcaactgttt tcagaggagt atgggtgctc gtttgaagga gatggggaag      1080
     ggcaggcctg tgatgccgca tcaacagaca atagaagggg accgggtggc ccctctcgtg      1140
     agggtgaggg aaaatccaga agaccggatg atgaagcagt caaagaatct cattgtgcac      1200
     aacctcattt ataaccttgc ctga                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page