(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE16

ACAM1_4.PE16         Location/Qualifiers
FT   CDS_pept        14446..15729
FT                   /locus_tag="AM1_C0016"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340471"
FT                   /db_xref="GeneID:5686238"
FT                   /translation="MAQGTNLLYQRYRSIALAVYICVLLAGLLDWLDGGLGPRSIITAP
FT                   DSLRFFVFASTVLALTGLELRTLVNGTYSPTRKKNVLLFLVRLVLFSGACLVTDLHYSK
FT                   ILFLPILLYGYFTVSQRLSYVIALLGVAILFILSAANIGGIRPPPPLGVSKLGGLIDRS
FT                   TGSLIALLFTLLLAQAMSEAIQAQQKLTHLLQSLESSHRQLQAYASRVADLAAIEERNR
FT                   LARDIHDSLGHHLAAINIQLEKASAYRERDSDRAYEAVKHAQETVQDALKDVRASVSSL
FT                   RQEGIPFAFQASLEELIRRMDHSDLDITLNQSGECVNYSSLKLMTLYRVLQEGLTNIHK
FT                   HAHASQAHINLNFGPQNITLELIDNGLGFDVAAWKSQKNQQTNHGIIGLQERLSLVGGT
FT                   LDITSHSQATTLAINIPQDLPQINYRAE"
FT                   /protein_id="YP_001521465.1"
     ATGGCTCAGG GTACCAATCT TCTTTATCAA AGATACCGCT CCATAGCATT AGCGGTTTAT        60
     ATCTGTGTGC TATTAGCAGG TCTTTTAGAT TGGCTGGATG GTGGTTTAGG TCCCCGTTCT       120
     ATCATCACAG CACCTGATAG CTTACGTTTT TTTGTTTTTG CTAGCACTGT TCTTGCACTG       180
     ACCGGGCTAG AACTCCGGAC GTTAGTCAAT GGAACTTATT CCCCGACCCG CAAGAAGAAT       240
     GTCTTACTCT TTTTGGTCAG GTTAGTGCTG TTTTCAGGTG CTTGTCTCGT CACTGATCTT       300
     CATTACTCGA AAATTCTGTT TTTACCTATT CTTTTGTACG GATACTTTAC AGTCAGTCAA       360
     AGATTGAGTT ATGTCATTGC TCTGTTAGGG GTTGCCATCC TATTTATCCT CAGCGCCGCT       420
     AATATTGGCG GCATAAGGCC ACCACCACCA TTAGGTGTGT CCAAGCTGGG CGGTCTGATT       480
     GACAGAAGTA CTGGCTCACT GATTGCCTTA TTATTCACAC TCCTGTTGGC CCAAGCCATG       540
     TCCGAGGCTA TCCAGGCTCA ACAAAAGCTT ACCCATTTAC TGCAGTCTCT GGAATCTTCC       600
     CATAGACAAC TTCAAGCTTA TGCCAGCCGA GTTGCTGATT TAGCAGCCAT AGAAGAACGG       660
     AATCGATTAG CTCGGGATAT TCACGATAGT CTGGGGCATC ATTTAGCCGC GATTAACATT       720
     CAACTGGAAA AAGCCAGTGC TTATCGAGAG CGAGATTCTG ACCGGGCCTA TGAAGCGGTT       780
     AAGCATGCCC AGGAAACTGT ACAAGATGCC CTCAAAGATG TGCGTGCATC CGTTAGCAGC       840
     TTACGTCAGG AAGGAATACC TTTTGCTTTT CAAGCTTCAC TAGAAGAATT GATCCGACGC       900
     ATGGATCATA GCGACCTTGA TATCACCCTA AACCAATCTG GAGAGTGTGT GAACTACAGT       960
     AGTCTTAAGC TGATGACGTT GTATCGCGTG CTCCAAGAAG GGTTGACCAA TATACATAAG      1020
     CACGCCCATG CCAGTCAAGC GCATATCAAC CTCAATTTTG GCCCTCAAAA TATCACGCTA      1080
     GAACTGATAG ATAATGGTTT GGGATTCGAC GTCGCAGCCT GGAAGTCACA GAAGAATCAA      1140
     CAAACCAACC ATGGCATCAT TGGCTTACAG GAACGCCTTA GTTTGGTGGG TGGAACCCTC      1200
     GATATCACCA GTCATTCCCA AGCCACAACC CTCGCTATCA ATATCCCCCA AGACCTTCCT      1260
     CAGATCAATT ACCGGGCTGA GTAA                                             1284
//

If you have problems or comments...

PBIL Back to PBIL home page