(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE18

ACAM1_4.PE18         Location/Qualifiers
FT   CDS_pept        16820..18298
FT                   /locus_tag="AM1_C0018"
FT                   /gene_family="HOG000023188" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RND family efflux transporter MFP subunit"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340473"
FT                   /db_xref="GeneID:5686240"
FT                   /translation="MAMMVLLSACTVQAADDAKKSKASPKIAAVDVAIAKPNTDHILDS
FT                   FTGTTAPIQEVMVRSQVDGQLQKLAVEVGDRVEKGQILGQQDDGVLTDTVNTARAEREA
FT                   QVVDVAKARSQVGAAKANVEQARLALVQAKGNVLQLQNAARANIEAARLEAQQNRQDAN
FT                   RLTQLANAGATSQQEAEQARTLAQRTQQTLVNTQANSVQEITQAQTAVKTAEQALQAAI
FT                   AQVDIEQGTVNATQRRVYAQQSVLNQALGQRSFTVLSAPLTGVVMERLSEAGNLLQTGD
FT                   SILRLGDFKKIKITIQVPARLLSQLRMGQQAKITLDAFPQQEWSGKITLISPLANTTSR
FT                   LLPIEILMDNPGKMSSGLLARVSFVQPQQGRVWVPEAAIQTSQSRKGPSSTPKPSNPDH
FT                   PSSQQRPSPQPPTDRKQTPTSNQATLFVLDKASPQPRVTSRQVQLGAQRNGQVEIIQGL
FT                   TSGESFVSRSSQPLKDGATVRLSALSESSSSVNP"
FT                   /protein_id="YP_001521467.1"
     TTGGCAATGA TGGTGTTGCT ATCGGCCTGT ACCGTTCAAG CAGCGGATGA CGCGAAGAAG        60
     TCCAAGGCTA GCCCTAAGAT TGCTGCCGTT GATGTTGCAA TCGCAAAACC GAATACGGAT       120
     CATATCCTGG ACTCCTTTAC AGGGACGACG GCACCGATCC AAGAAGTGAT GGTGCGATCT       180
     CAAGTGGATG GACAACTGCA AAAACTAGCG GTAGAGGTCG GTGATCGGGT CGAGAAAGGA       240
     CAGATCCTAG GACAACAAGA TGATGGGGTT CTCACCGACA CGGTCAACAC CGCCCGCGCT       300
     GAAAGAGAAG CCCAGGTGGT CGATGTCGCT AAAGCCCGTA GCCAAGTGGG AGCTGCTAAG       360
     GCCAACGTTG AACAAGCCCG TCTCGCCCTA GTCCAAGCGA AAGGTAATGT TCTACAGTTG       420
     CAAAATGCTG CCCGCGCCAA TATTGAAGCT GCCCGTCTCG AAGCCCAACA AAACCGCCAG       480
     GATGCAAACC GATTAACGCA ACTCGCTAAT GCAGGTGCAA CATCCCAGCA AGAGGCCGAA       540
     CAGGCCCGCA CCTTAGCCCA GCGAACACAG CAAACCTTGG TGAATACCCA AGCCAACAGT       600
     GTCCAGGAAA TCACCCAGGC CCAAACCGCC GTCAAAACTG CTGAACAAGC CTTACAGGCT       660
     GCCATCGCCC AAGTTGACAT TGAGCAAGGC ACCGTTAATG CAACCCAAAG AAGAGTCTAT       720
     GCTCAGCAAT CTGTTCTCAA CCAAGCCCTA GGGCAGCGAT CCTTTACAGT GCTCTCAGCG       780
     CCCTTAACCG GCGTCGTTAT GGAGCGCTTA AGCGAAGCAG GCAATCTCTT ACAGACCGGC       840
     GATTCGATTC TGCGTCTCGG TGATTTCAAA AAGATTAAAA TCACTATTCA AGTCCCCGCC       900
     AGGCTGTTGT CTCAACTTCG CATGGGACAA CAGGCCAAGA TCACCCTGGA TGCCTTTCCC       960
     CAACAAGAAT GGTCTGGCAA AATCACTCTC ATTTCGCCCC TCGCCAACAC CACATCGCGG      1020
     TTGTTACCTA TCGAAATTTT GATGGATAAC CCCGGCAAAA TGAGCAGTGG GCTACTGGCT      1080
     CGAGTCAGCT TTGTCCAACC GCAACAAGGT CGGGTTTGGG TGCCTGAGGC TGCCATACAG      1140
     ACCAGTCAAT CTCGGAAAGG TCCATCCTCC ACACCCAAAC CGTCTAATCC AGATCACCCT      1200
     TCATCCCAGC AGCGCCCGTC ACCGCAGCCA CCTACAGATC GCAAACAGAC ACCCACCTCC      1260
     AACCAAGCCA CCCTGTTTGT GCTCGACAAA GCTAGTCCAC AGCCCCGCGT CACCTCTCGC      1320
     CAAGTTCAGT TGGGGGCGCA ACGCAATGGT CAAGTGGAAA TCATTCAAGG GCTGACCTCA      1380
     GGCGAATCCT TTGTCAGTCG TAGCAGTCAG CCCCTAAAGG ACGGAGCCAC CGTCCGCTTG      1440
     AGCGCCCTCT CAGAATCGTC ATCTTCGGTG AACCCCTAA                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page