(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE19

ACAM1_4.PE19         Location/Qualifiers
FT   CDS_pept        18298..21555
FT                   /locus_tag="AM1_C0019"
FT                   /gene_family="HOG000158131" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acriflavin resistance protein, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340474"
FT                   /db_xref="GeneID:5686241"
FT                   /translation="MERSTLSLSTLSIRRHIGVFMLTLTIVVLGLFFLSTLQVDLLPSI
FT                   TYPRIGVRLEAPGISPDVAVDEITDPLEEALLATEGVVQIYSRTQEGSVSVDLYFQPGG
FT                   NIDQALNDATAALNRALNDLPDTIEQPRLFKFDPSQLPVYEMALTSPGLDDSELRVFAE
FT                   ETLNRELGLVPGVSSAEVSGAADEEIQINLDLNRMQTIGVSMTEVLNALSTRNQDISGG
FT                   QILGQLTEPLTRTIGQFQSVDEIESLILNVAALSSTNETGGAPLSTTQQALQGDQQVYL
FT                   RDIAEVVDGAAEQRVFVNLNQTPAVKLSLQKQPDANTVVVVDGIKAKLAELVQREIIPA
FT                   EMVIIPTLDESVFIRNAIRNVAISGLSGMVLAALAVLLFLGSLRQTLIIVLAIPLATLT
FT                   SIILMRLFGLSMNVFSLGGLALGVGIVVDNAIVMLETIVQGTQTQASNNGYSKQEKILR
FT                   QAEQSSRQVESALVASTSTNLVAVLPFLMIGGFIALLFNELLLTISFAISASILIALTV
FT                   VPMLASRLLMVHRSSRVGQTWLLVQFRERFERATLSYCRGLGWVLKWRWQVVVSAILIL
FT                   GISSLGMLEQIPQEILPPINTGQASLVAQFPVGTTLEQNRLVMAKVEAILAEQPETAYA
FT                   FITAGGSIRGTNLSENPLRGSGSITLKPNADVEAYTQKVSQAIDKLNLVDIRIRVSPGQ
FT                   VRGLITSNSPIRGADIDVMLQGENSQRLSQAGRQVLGALSDQVTGARFRPDNDPDQPEL
FT                   QISPDWERVAALGLSAQQIGETIQTAVEGWVPTQLQQGSRLIDIRVQLDPKSLQMEEQL
FT                   AQLPLFTEGNQFVQLADVAQIGVGAAPLEIQRINQQPVYLVGGNLAEGARLSDALAEVE
FT                   SVLTTLTLPDGVSLLPSTAAQSNRALQQALQTLGGLAAFLVFVVMAVQYNSLIDPLVIL
FT                   FTVPLALSGGLFGLYITQTAIGATVIVGVVLLVGIVVNNAIIMVELANQIYFQSGQDRQ
FT                   AAILQAAPQRLKPIMMTTMTTVLGMLPLALGIGQGSEFLQPLGIVVFAGLSLATLLTLY
FT                   IIPCFYVILHNAECQQRGLSLKTKTLPFHRLFQRLRS"
FT                   /protein_id="YP_001521468.1"
     ATGGAAAGGT CTACCTTAAG CCTCAGCACC CTCTCCATTC GACGACATAT TGGCGTATTC        60
     ATGTTGACCC TGACCATCGT AGTGTTGGGC CTGTTTTTTC TCTCGACCCT GCAAGTGGAC       120
     TTGCTGCCCT CCATTACCTA TCCCCGGATT GGGGTGCGGT TAGAAGCACC TGGTATTTCC       180
     CCCGATGTTG CGGTTGATGA AATCACCGAT CCCCTAGAGG AAGCCTTGCT GGCGACAGAA       240
     GGCGTAGTGC AAATTTACTC CCGAACGCAA GAAGGGTCCG TCAGCGTTGA TCTCTATTTT       300
     CAGCCTGGGG GCAATATTGA CCAAGCCCTC AACGATGCCA CCGCGGCCTT GAATCGCGCC       360
     CTCAATGATC TACCTGACAC CATTGAGCAG CCCCGTCTGT TTAAATTTGA CCCCTCACAA       420
     TTACCGGTCT ACGAAATGGC CCTGACATCG CCAGGCCTGG ACGACTCAGA ACTCCGAGTG       480
     TTTGCTGAGG AAACCCTGAA CCGAGAGTTG GGACTCGTCC CTGGGGTCTC GTCCGCTGAA       540
     GTCTCTGGGG CCGCAGACGA AGAAATTCAG ATCAATCTTG ACCTCAACCG GATGCAGACT       600
     ATCGGGGTGA GTATGACGGA GGTACTCAAC GCGCTCAGTA CCCGCAATCA GGATATTTCT       660
     GGAGGGCAGA TCCTGGGACA GCTGACTGAA CCGCTCACAC GCACGATAGG GCAATTTCAA       720
     TCTGTCGATG AGATTGAATC CCTGATTTTG AATGTGGCTG CTCTGTCTTC TACCAATGAG       780
     ACAGGGGGCG CTCCCCTCTC CACCACTCAG CAGGCCCTGC AGGGAGACCA ACAGGTGTAC       840
     CTCCGGGATA TTGCCGAGGT CGTGGATGGA GCGGCTGAGC AGCGGGTGTT CGTCAATCTC       900
     AATCAAACCC CTGCGGTTAA ACTTAGCCTG CAAAAACAGC CCGATGCCAA TACAGTCGTG       960
     GTGGTGGATG GTATCAAGGC CAAGCTGGCA GAGCTGGTGC AACGAGAAAT TATTCCCGCC      1020
     GAGATGGTGA TTATTCCGAC CCTAGACGAG TCAGTCTTTA TTCGCAATGC GATTCGTAAT      1080
     GTTGCCATCT CAGGGCTCAG TGGGATGGTG CTGGCCGCAT TGGCGGTCTT GCTCTTTTTG      1140
     GGGTCTCTAC GACAGACCCT GATTATTGTG CTGGCCATTC CCTTAGCAAC CCTCACTTCC      1200
     ATTATTTTGA TGCGGCTGTT TGGTCTCTCC ATGAATGTGT TTAGCTTAGG TGGCTTAGCC      1260
     CTTGGTGTCG GCATTGTGGT GGACAACGCC ATTGTCATGC TGGAGACCAT TGTTCAGGGC      1320
     ACCCAGACCC AAGCCTCGAA TAATGGATAT TCGAAGCAGG AGAAGATCCT CAGGCAGGCG      1380
     GAGCAGAGCA GTCGGCAAGT GGAATCAGCC TTGGTAGCAT CCACGAGTAC CAACTTGGTA      1440
     GCTGTCTTAC CGTTTTTAAT GATTGGTGGA TTTATTGCCC TCCTCTTTAA TGAACTCCTC      1500
     CTCACCATCA GTTTTGCGAT TAGCGCTTCA ATTCTAATTG CCCTGACGGT CGTTCCGATG      1560
     TTAGCCTCGC GGCTATTGAT GGTTCATAGA TCGAGTCGGG TCGGTCAAAC CTGGCTGCTC      1620
     GTGCAGTTTC GAGAACGGTT TGAGCGTGCG ACCCTGAGCT ATTGTCGAGG TTTAGGATGG      1680
     GTCTTGAAAT GGCGATGGCA AGTGGTCGTA AGCGCGATTC TGATCCTCGG TATCAGCAGT      1740
     CTAGGGATGC TAGAGCAAAT TCCACAAGAA ATTTTGCCGC CAATTAATAC AGGGCAGGCC      1800
     TCATTGGTGG CTCAGTTCCC TGTGGGGACA ACCCTAGAGC AGAATCGCCT CGTCATGGCG      1860
     AAGGTAGAAG CAATTTTAGC TGAGCAACCA GAGACCGCCT ATGCTTTCAT AACGGCTGGG      1920
     GGGTCTATTC GAGGGACGAA TCTGAGTGAA AATCCGTTGA GGGGTTCGGG TTCCATTACT      1980
     CTGAAGCCCA ACGCTGATGT GGAGGCCTAT ACCCAGAAGG TTAGCCAAGC AATTGACAAG      2040
     CTGAACTTGG TGGATATCCG AATCCGCGTT TCTCCTGGGC AGGTGCGTGG GTTGATTACC      2100
     AGTAATTCGC CGATTCGAGG AGCAGATATT GATGTGATGC TGCAGGGTGA AAATTCACAG      2160
     CGGTTAAGCC AGGCTGGCCG ACAGGTGTTA GGCGCTCTGA GTGATCAAGT GACTGGGGCG      2220
     CGGTTCCGTC CAGACAATGA TCCGGACCAA CCTGAGCTGC AGATCTCCCC TGACTGGGAA      2280
     CGAGTTGCGG CTCTGGGGCT ATCTGCCCAA CAGATTGGTG AGACGATTCA GACGGCTGTG      2340
     GAGGGTTGGG TGCCTACGCA GCTCCAGCAA GGGAGTCGTC TCATTGATAT TCGCGTCCAG      2400
     CTTGATCCCA AATCCCTGCA AATGGAAGAG CAATTAGCCC AACTCCCCCT GTTTACGGAG      2460
     GGTAATCAGT TTGTGCAGCT TGCGGATGTG GCCCAGATTG GTGTAGGAGC AGCTCCTCTA      2520
     GAAATCCAGC GGATTAATCA GCAACCCGTC TACTTAGTGG GGGGTAACTT AGCTGAAGGG      2580
     GCGCGGCTAA GTGATGCCCT GGCGGAGGTG GAGTCGGTGT TAACAACCCT TACCCTTCCA      2640
     GACGGCGTGT CTCTACTGCC CAGCACAGCG GCCCAGAGTA ATCGAGCGTT ACAACAGGCA      2700
     CTGCAAACGT TAGGGGGCCT GGCGGCATTT CTGGTCTTCG TGGTGATGGC CGTGCAATAT      2760
     AACTCTCTGA TCGATCCCCT TGTTATTTTG TTTACGGTTC CCTTGGCCTT GTCGGGAGGC      2820
     CTTTTTGGTC TCTACATTAC CCAGACTGCC ATCGGTGCCA CGGTGATTGT GGGGGTGGTT      2880
     CTATTGGTGG GGATTGTCGT CAATAACGCC ATCATCATGG TGGAGTTAGC CAATCAGATC      2940
     TATTTTCAGT CCGGGCAAGA TCGCCAAGCT GCCATTTTGC AGGCAGCGCC CCAACGCTTA      3000
     AAGCCCATTA TGATGACCAC CATGACCACG GTGTTGGGGA TGCTTCCCCT AGCTCTCGGC      3060
     ATTGGTCAAG GTTCAGAGTT TTTGCAACCG TTGGGCATCG TGGTTTTTGC CGGACTCTCC      3120
     TTAGCAACCT TGCTTACCCT GTATATTATT CCTTGCTTTT ATGTGATTCT TCATAATGCC      3180
     GAGTGCCAGC AAAGAGGCCT TTCACTAAAA ACAAAGACAT TACCTTTCCA TCGTCTTTTT      3240
     CAAAGGTTGC GCTCTTAA                                                    3258
//

If you have problems or comments...

PBIL Back to PBIL home page