(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE2

ACAM1_4.PE2          Location/Qualifiers
FT   CDS_pept        330..467
FT                   /locus_tag="AM1_C0002"
FT                   /gene_family="HOG000022973" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340457"
FT                   /db_xref="GeneID:5686224"
FT                   /translation="MKEAGFSENSRSREGHPKLAKDAAIAKPYLVAMTAGLQEMATETL
FT                   "
FT                   /protein_id="YP_001521451.1"
     TTGAAGGAGG CAGGATTTTC GGAAAATTCG CGATCGCGTG AAGGCCATCC CAAACTGGCG        60
     AAAGATGCTG CGATCGCGAA GCCGTACCTT GTCGCAATGA CAGCAGGACT CCAAGAAATG       120
     GCTACGGAGA CTCTGTAG                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page