(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE20

ACAM1_4.PE20         Location/Qualifiers
FT   CDS_pept        21749..22207
FT                   /locus_tag="AM1_C0020"
FT                   /gene_family="HOG000034464" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340475"
FT                   /db_xref="GeneID:5686242"
FT                   /translation="MTDYPRNFKLNRTDIAISYLLLRLLIGVNFLNHGLTRIGNIPSFV
FT                   ESMVKAMENSYFPEPLVRINAFLVPVVELIVGLLIILGWQTRIALTITSGLMVILMLGV
FT                   TSVQNWQAAGDQLVYGVILFILLACRSFNTVSVDYWLKRKTTPSERSR"
FT                   /protein_id="YP_001521469.1"
     ATGACTGACT ATCCCAGAAA TTTCAAGTTA AACCGAACCG ATATTGCGAT CTCATATTTG        60
     CTACTCCGCC TCCTGATTGG CGTCAACTTT CTCAATCATG GACTAACACG GATTGGCAAT       120
     ATTCCAAGCT TTGTCGAAAG TATGGTGAAA GCCATGGAGA ATTCGTACTT TCCTGAACCC       180
     TTGGTTCGCA TCAATGCTTT TTTAGTTCCT GTTGTAGAAC TGATTGTGGG TCTGCTCATC       240
     ATTTTAGGTT GGCAAACCCG TATTGCGCTG ACAATTACAT CTGGTCTGAT GGTGATTCTG       300
     ATGCTCGGTG TTACCTCAGT TCAAAATTGG CAAGCCGCAG GGGACCAGTT GGTCTATGGT       360
     GTGATTTTGT TCATCCTGTT GGCCTGTCGT AGTTTCAATA CTGTTTCAGT GGACTATTGG       420
     CTAAAGCGTA AAACGACACC ATCAGAACGA TCTCGGTAA                              459
//

If you have problems or comments...

PBIL Back to PBIL home page