(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE22

ACAM1_4.PE22         Location/Qualifiers
FT   CDS_pept        22619..22822
FT                   /locus_tag="AM1_C0022"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340477"
FT                   /db_xref="GeneID:5686244"
FT                   /translation="MVGDIDLFAQECIAYATKLSAAGIPAELHVYPGGVHGFEDANPEA
FT                   RISKQFLATRDSTLKAALENQI"
FT                   /protein_id="YP_001521471.1"
     ATGGTCGGCG ATATTGATTT ATTCGCCCAG GAATGCATCG CTTATGCTAC TAAACTCTCG        60
     GCAGCAGGAA TTCCGGCAGA ATTACACGTC TACCCAGGCG GTGTTCATGG GTTTGAAGAT       120
     GCGAACCCCG AAGCGCGTAT CTCAAAACAG TTTCTCGCCA CGCGGGACAG CACATTGAAA       180
     GCGGCTTTGG AGAATCAGAT TTGA                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page