(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE25

ACAM1_4.PE25         Location/Qualifiers
FT   CDS_pept        complement(26367..26504)
FT                   /locus_tag="AM1_C0025"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340480"
FT                   /db_xref="GeneID:5686247"
FT                   /translation="MLILNPFLIKSIEGMLIDTNGFGFSYLYGLRLAGCIAGATRSDGW
FT                   "
FT                   /protein_id="YP_001521474.1"
     atgttaatcc tcaatccctt cctaattaag agcattgagg gcatgttgat agataccaac        60
     ggttttggat ttagctattt gtatggtctg agattagctg gctgtattgc tggggcaaca       120
     cgaagtgacg ggtggtaa                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page