(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE26

ACAM1_4.PE26         Location/Qualifiers
FT   CDS_pept        complement(26476..26616)
FT                   /locus_tag="AM1_C0026"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340481"
FT                   /db_xref="GeneID:5686248"
FT                   /translation="MLQSAHNRGDLRLKYQPPTQLQIASNWGIATIDAKRGHVNPQSLP
FT                   N"
FT                   /protein_id="YP_001521475.1"
     ttgctccagt cagcccataa tcgtggagac ttaaggctga aatatcaacc cccaactcaa        60
     ttacagattg cctctaattg ggggatagca acgattgatg caaaaagggg tcatgttaat       120
     cctcaatccc ttcctaatta a                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page