(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE27

ACAM1_4.PE27         Location/Qualifiers
FT   CDS_pept        complement(26697..27077)
FT                   /locus_tag="AM1_C0027"
FT                   /gene_family="HOG000023190" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340482"
FT                   /db_xref="GeneID:5686249"
FT                   /translation="MKKHLQLLILTSLVSALPAKANPVADACFNSLIEHPDDRPDTAVL
FT                   SLTVEHNGSQYHVIDTTYRRPQPNPASRTYIRTDDRGGCEEILSYQIGSHPEADVYRER
FT                   LGSQVFDKVRQAFRQQQQQQQR"
FT                   /protein_id="YP_001521476.1"
     atgaaaaaac atttacagtt attaattcta acgagcttgg tctcagccct gcctgccaag        60
     gctaatcctg ttgccgatgc gtgctttaac tcactcatcg aacaccccga cgatcgccca       120
     gatacagcgg ttctatcgtt gaccgtagag cataacggaa gccaatatca tgtcattgat       180
     acaacctatc gcagacctca acccaatccc gcctcaagaa cttatatcag aactgatgac       240
     cgaggcggct gtgaggagat cctttcatac cagatagggt cacaccccga agctgatgtt       300
     tacagagaaa gattaggctc tcaagttttt gacaaggtta ggcaggcatt cagacaacaa       360
     caacaacaac aacagcgttg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page