(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE28

ACAM1_4.PE28         Location/Qualifiers
FT   CDS_pept        complement(27088..28317)
FT                   /locus_tag="AM1_C0028"
FT                   /gene_family="HOG000023119" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="M23 peptidase domain-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340483"
FT                   /db_xref="GeneID:5686250"
FT                   /translation="MQAKAEAEGVDLQPIDGSTGAPQLKGIPGQPGSDAAKSKFASASG
FT                   QSTGTQGTKAQTIGKSAWGSETDVHNLILTSALESTGTQNQIDVAVAIMNRVVSPKHPN
FT                   TITDVVFQPKQYEPNFGQAPVTSKEEAISRIARKTRSIQSAISTYETIEKALNDPNAIA
FT                   ASQAFLKGATDFRGQDWLHIRQPGDPYRGNTGANFYFQESQDPAIAAATLGVLGVESTA
FT                   VDPNSIYASASGHSIPCRPGAIASAGTVPFQQGSGVATGRLADPLGSHNYKLTSNYGPR
FT                   VNPVTGVPGFHYGIDLAHFAGTPFAAADGGVVVESFWNGDYGNWILIDHGNGLATWYAH
FT                   NKVNYVKAGDTVDPGQLIGEVGSTGNSTGPHIDLGVIEGYVTGNRDSGTVVNPRKYFNL
FT                   PPVGTFNQPQ"
FT                   /protein_id="YP_001521477.1"
     ttgcaagcta aggcagaagc tgagggtgta gaccttcaac ccattgatgg gtcaacaggt        60
     gcgccgcaat tgaagggtat accaggtcag ccaggttctg atgccgctaa gtctaagttc       120
     gcttcagcga gtggtcaaag cactggaacg caagggacaa aggcccaaac tattggcaag       180
     tctgcttggg gaagcgaaac agatgttcac aacctaattt tgacatcagc attggaaagc       240
     actgggacac aaaatcaaat tgatgtcgct gtggcaatca tgaaccgggt tgtttctccc       300
     aagcacccaa atacaattac ggatgtggtg ttccagccga agcaatatga acctaacttt       360
     ggtcaagccc cggtaacttc caaagaagaa gccatcagcc gtattgctag aaaaacccgt       420
     agcatccaaa gtgctatctc aacttacgaa accatcgaaa aagcacttaa cgatccgaat       480
     gctattgcgg cctcacaagc ttttctcaaa ggtgcgactg actttagagg tcaggattgg       540
     ttgcacattc gccaaccggg tgatccctat cgggggaata ccggggcaaa cttctatttt       600
     caggagtcac aggatccagc tatcgcagcg gcaacgttag gagtgttggg cgttgagagt       660
     acagcggttg atccaaacag catttatgcg tccgcctcgg gccattccat cccttgtagg       720
     cccggtgcga ttgcaagtgc agggactgtg ccttttcagc aaggatcagg agtcgcaaca       780
     ggaaggctcg ccgatccatt ggggagtcat aattacaagc tgaccagtaa ctacggccca       840
     cgggtaaatc ctgttacagg cgttccgggc tttcactatg gtattgatct ggctcatttt       900
     gcaggaactc ctttcgcggc tgctgatggt ggcgtggtcg ttgagagctt ttggaatggg       960
     gactacggta actggattct gattgaccac ggtaacggct tagccacttg gtacgcacac      1020
     aataaggtta attacgttaa agcgggggat actgtagatc cggggcagtt aattggcgaa      1080
     gtcggaagta caggcaattc aacaggtcct catattgact taggcgtaat tgaggggtat      1140
     gtcacaggga atcgtgactc aggaactgtc gtaaacccaa gaaaatattt caatctcccc      1200
     ccagtaggaa ccttcaatca acctcaataa                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page