(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE3

ACAM1_4.PE3          Location/Qualifiers
FT   CDS_pept        complement(475..1260)
FT                   /locus_tag="AM1_C0003"
FT                   /gene_family="HOG000022974" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340458"
FT                   /db_xref="GeneID:5686225"
FT                   /translation="MKTLRWLIDLHPEFPASEIVAEYLRQHKKIEPIVIDRDDVMLGRW
FT                   PDTEDWIVGYGTMFAMTRLLRHPPLSTAIFDDYSSLRCSKYYSYIYPFLGRAFLFAPFG
FT                   ALPNLPLQRMFGDNIFVRSDTNYKLFPAEVLKTQELPHWVKTYSHHQNELAVVSEVVSF
FT                   ETEYRCFCRNGIFFCGSSYPDEPYSEVPQEIRSVAESVAQALGVTGMNMLTIDIGIHAG
FT                   EPKLVEIGGVNSWGIYGSNVADFIAAMEEEAIDRWEDFI"
FT                   /protein_id="YP_001521452.1"
     atgaagactt tgcgctggct gatagacttg cacccagagt tcccagcatc ggagatagtt        60
     gcagaatatt taagacaaca taagaaaata gagcccatcg tcatcgatcg ggacgatgta       120
     atgttaggta gatggccaga tactgaagat tggattgtgg gctacgggac gatgtttgct       180
     atgacccgct tgctcaggca tccacctctc agtacagcta tttttgacga ttattcgagt       240
     ctaaggtgct ctaaatacta ttcttacatc tatccttttt taggacgtgc tttcctattt       300
     gcaccatttg gagcactacc caatttaccc cttcaaagga tgttcggaga taatattttt       360
     gtccgttccg ataccaatta caagcttttc cccgcggagg tcttaaaaac ccaagagctt       420
     ccacattggg taaagaccta ctcacatcat caaaatgagc tagctgtagt ctctgaagtg       480
     gtttcatttg agactgaata ccgttgcttt tgccgaaacg gcatattctt ttgcggcagc       540
     tcgtatccag acgagccata ctctgaagtg cctcaggaga taagatccgt tgccgagagt       600
     gttgcacaag ccttgggcgt aactggtatg aatatgctga ctattgacat tgggatacat       660
     gctggcgaac ctaagcttgt ggaaattggc ggggtcaaca gctgggggat ttatggatcg       720
     aatgtggctg attttattgc tgctatggag gaagaagcca tagaccgttg ggaagacttt       780
     atctga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page