(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE30

ACAM1_4.PE30         Location/Qualifiers
FT   CDS_pept        complement(30344..31792)
FT                   /locus_tag="AM1_C0030"
FT                   /gene_family="HOG000022985" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340485"
FT                   /db_xref="GeneID:5686252"
FT                   /translation="MSEIKTKKEALAAINKTKPKAKPTQPDPSQVQPQEPVPATLQDFH
FT                   LPELTHEFDAQTPTKTRRRLPIQIGVIGGSIFLILAVVQAVTSGNSDTPKPAVATRPQP
FT                   TIGMPEDDKDAIIKSQALQISELKQKYETGNVTNAPGQNKLTAVPQKPIVVPKTKPAQP
FT                   NRRPPSAAHRVTRPIQVRRSVPPSQPRIVYRNRPAPKPAVAARPPAPRPVAQAPKPAAN
FT                   FSLAQQSAFTPKPVQPARPVTPKPIRPIKVSTSHPVRKPITTKPFAKVPPTPPQGILVA
FT                   SLTGDLLEDNQVSDTPTALYPASSSPLGKGLISPGTTAKAKLDNPITWIPQNSDAIIGQ
FT                   RYLLTLSEDLGAMAKKGSKVIAEVTSAEGDFLSMQVVEVNQQPIEHVNLTDDSPEARKT
FT                   PVAVVQYKQSPYLQAKLKGQGEGFGNKLLRAGLNVGIDQLRSSSVGDRASSLVNSFAPN
FT                   RSSRSRSGLYHFDKEVEIYFVEGV"
FT                   /protein_id="YP_001521479.1"
     atgagcgaga tcaagaccaa gaaagaagcc ctagctgcga ttaacaagac caagcccaag        60
     gccaaaccaa cccagccaga cccatcacag gtacaaccac aagaacccgt acccgccact       120
     ctgcaagact tccatttacc ggaactgacc catgagtttg atgcccagac cccgaccaag       180
     acaaggcgac ggctacccat ccagattggg gtgattggag ggagtatctt tttgattctg       240
     gcggtggttc aagccgtgac atcggggaac agtgatactc ccaagcctgc ggttgccacc       300
     aggccccaac ccacaattgg gatgccagag gatgataagg atgccattat caagagccaa       360
     gcccttcaaa tttctgagct aaagcagaag tatgaaacgg ggaatgtgac caatgcccct       420
     ggtcagaaca agctcacagc ggttccccag aagccgatag tggtgccgaa gacaaagcca       480
     gcccagccta accgcagacc gcccagtgca gctcatcggg tgacccgacc catccaggtg       540
     cgtcggtctg tacccccatc tcaacctcga atcgtttatc gcaatagacc tgctcccaag       600
     cctgcggttg cggctagacc ccccgccccg agacccgtcg cccaagcccc caagcctgct       660
     gctaacttta gccttgccca gcagtcggcc tttactccga agcccgtgca gcctgctcga       720
     cctgttacgc caaagcccat tcgtcccatc aaggtatcca cctctcaccc cgtccgtaaa       780
     ccgattacca cgaaaccttt tgctaaagtg ccacctacac caccccaagg aatactggtg       840
     gcttctttga cgggtgattt gctggaagat aatcaggtat ccgatacacc cactgccctc       900
     tatcccgcta gcagtagccc attgggtaaa ggactgattt cccctggtac gaccgccaag       960
     gccaagctcg ataacccgat tacctggata ccccaaaaca gtgacgcgat catcggtcag      1020
     cggtatctgt tgaccttgag tgaagactta ggggcaatgg cgaagaaagg ctccaaagtc      1080
     attgctgaag tgaccagtgc ggagggcgac ttcttgagta tgcaagtggt ggaagtcaat      1140
     cagcagccca ttgagcatgt caatctgacg gatgactcac cagaggctag aaagacgcct      1200
     gttgccgttg tccagtataa gcagtctccc tatctgcaag ccaagctcaa aggccaagga      1260
     gaaggctttg gcaacaaact cttgagagcg ggcttgaacg tcggcattga ccagcttcgc      1320
     tctagcagtg tgggagatag agcctcatcc ctcgtgaata gctttgctcc caatcgctct      1380
     agtcgttctc gcagtggcct ctatcacttt gataaggaag tggaaattta cttcgtggag      1440
     ggggtttag                                                              1449
//

If you have problems or comments...

PBIL Back to PBIL home page