(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE31

ACAM1_4.PE31         Location/Qualifiers
FT   CDS_pept        complement(31792..32511)
FT                   /locus_tag="AM1_C0031"
FT                   /gene_family="HOG000022986" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340486"
FT                   /db_xref="GeneID:5686253"
FT                   /translation="MLKLQDPTETHKKQPPYVLYAILGVFTLNFFSSCGAFLSSSRSAQ
FT                   LASDQSTIYVQTQDDETVQAEKVDPLHREDALLRTYAYELVKVGWTWNGGSPPKKHNDH
FT                   IYPGELFAVAQSIDPLLRDGWLEIEHQKYEKAQQPIQEYLSGQWQSVVEIKRDTDIHLT
FT                   QIQPGQWQIHVISIRTHRSKDGKSFPEKLNKKLVVEAVIPTEGEAQRLFGDSYSQLNHL
FT                   ITKYQRHGLMITSIEDF"
FT                   /protein_id="YP_001521480.1"
     atgctaaaac tccaagatcc caccgaaacc cacaagaagc agccccccta tgtgctgtat        60
     gccattttgg gggtgttcac cctcaacttc ttctcaagct gtggagcgtt cctctccagc       120
     tcccgcagtg cccaactcgc atcagaccaa tccaccatct acgtccagac ccaggacgat       180
     gagaccgtcc aggctgaaaa agtggacccc ttgcatcggg aggacgccct cctgagaacc       240
     tatgcctatg aactcgtcaa agtgggctgg acctggaatg ggggcagtcc tcccaagaag       300
     cataacgacc acatttatcc aggggagcta tttgccgtag cccagtccat cgaccccctg       360
     ctccgggacg gctggctaga gattgagcat cagaaatatg agaaagctca gcagccgatc       420
     caagaatacc tgtcgggtca atggcagagc gtcgttgaga ttaagcggga tacggatatc       480
     catctcaccc agatccaacc gggtcagtgg cagatccatg tgatttccat ccgtacccat       540
     cggtccaagg acggtaaatc cttcccggag aaattgaata aaaagctcgt ggttgaggcg       600
     gtgattccca cggaagggga agcccagcga ctgtttgggg actcttatag ccaactcaac       660
     cacctgatca ccaagtacca gcgtcacggc ctgatgatta catcaataga ggatttctaa       720
//

If you have problems or comments...

PBIL Back to PBIL home page