(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE32

ACAM1_4.PE32         Location/Qualifiers
FT   CDS_pept        complement(32541..33821)
FT                   /locus_tag="AM1_C0032"
FT                   /gene_family="HOG000022988" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340487"
FT                   /db_xref="GeneID:5686254"
FT                   /translation="MSVIGLTLLFIALGEVSAHAINEDLDPSVGVDLLRQSKIRMFETS
FT                   QWWDELWNDILGDNPRTTVNNKAMFSILLPFLLVACLVLMARAGYSFLSGETHRIVLQQ
FT                   IVPIVLLLAFTLNYGWGAKAVAWSFREVANRGSELILDSQWAGLVVRDALKDKIHAASA
FT                   IAEYNRQSASCSRLPAITLRDPAAASSSQGLDQVQASKVQTAVRCLELLAQKLERDEAA
FT                   IKKDCPSCETAQQVIESRKKGIQADLGRISAAIFNTLNPIDDAIHGFNVVKENAVRTVS
FT                   IEGPLQIQYWFVSGQELALILSGILAPIMIIYSTLPIAGHKWAVLQYLKALVIIALVRF
FT                   AYIFVIGFGAIYLTDNPIADQGAAFATFLGYVAPAVATAAVTVGALAASGVYTGAVVTT
FT                   VGAAVTVVSSAALSASSAVTSRALRNR"
FT                   /protein_id="YP_001521481.1"
     gtgtccgtca tcggtctcac cctactgttt atcgccttgg gtgaagtgtc agcccatgcc        60
     attaatgagg acctcgaccc ttccgtgggt gtagacctgc tgcggcagtc caagatccgc       120
     atgtttgaga cctcccaatg gtgggatgag ttgtggaatg acatcctcgg agataatccc       180
     cggacgaccg tcaataacaa ggcgatgttt agcatcctgc tgccctttct gctcgtggcc       240
     tgcctcgtgc tgatggcgag agcgggatac agctttttga gtggggaaac ccatcggatt       300
     gtcttgcagc agatcgtccc catcgtctta ctcctcgcct ttaccctcaa ctatggctgg       360
     ggggcgaaag ccgttgcctg gagttttcgg gaggtggcga atcgagggag cgaactgatc       420
     ctcgattccc aatgggcggg gctagtggtc cgggatgccc tcaaggacaa gattcatgcg       480
     gcctcagcga tagccgaata taaccgccag tctgcgagct gttctcgtct gccagcgatc       540
     accctcagag accccgcagc cgcttcttcc agtcaaggac tggaccaggt tcaagcctcg       600
     aaagtgcaaa ccgccgtgcg ctgcttggag ttgttagccc aaaagctgga acgggatgag       660
     gctgccatca agaaagactg cccgagctgt gagacagctc agcaagtgat tgaaagtcgt       720
     aagaaaggga ttcaagccga tctaggccgc attagtgccg cgatatttaa caccttgaac       780
     cccattgatg atgccataca tggcttcaac gtggttaaag agaatgcggt acggaccgtc       840
     tctattgaag gtcccctcca gatccaatac tggtttgtct ccggccaaga actggccttg       900
     attctgtcag ggatcttagc cccaatcatg atcatctatt ccaccctacc gatagcgggt       960
     cataagtggg ctgttttgca gtacctgaaa gccctggtca ttattgccct agtgcgattc      1020
     gcctatatct tcgtgattgg gtttggggcg atctatctga cggataaccc catcgcggat      1080
     caaggagccg cctttgctac cttcttaggc tatgtcgccc ctgcagtcgc cacggctgcg      1140
     gtgacggtgg gggcattagc tgcatcaggg gtctatacgg gagctgtggt gaccaccgtg      1200
     ggagcagcag tgaccgttgt gtcatccgct gccttatccg cgagttcagc cgtcacctcc      1260
     agagccttga gaaatcgata a                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page