(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE33

ACAM1_4.PE33         Location/Qualifiers
FT   CDS_pept        complement(33829..34980)
FT                   /locus_tag="AM1_C0033"
FT                   /gene_family="HOG000022989" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340488"
FT                   /db_xref="GeneID:5686255"
FT                   /translation="MQPKPLLITLVLSVQATITTVPAYAQVSYDDPVISGDITLPTTTA
FT                   PTTFPDVPIPTGDVTIAKDNPLDTATYTEVPTAQLPSGLLGTVFNVLGPKQKPGQARVI
FT                   NETQRKILKVYEYGQKALDAYKVGRAIYDAIDNFSLKRILSGSVSSILANYDKLGTNGT
FT                   SGSQQGGSGSEDPIYSDPQDPFQVYTQARNNEARKALLPQLMTQLVFSEDGQALIQQQG
FT                   EQVQQSVVNTIESTQALVQLSAASKEQATAGAGIATSVGETGQKAQTLKSSQAVLKSLT
FT                   AQNSLMAQGTATNGAILSNVVSGQEEQKKSSDALVVGSALAHQQRTTGLHLSASELTLQ
FT                   EQIRAELELYKDERHRAQDQAALREQLSFNYLYIPGLYSETTP"
FT                   /protein_id="YP_001521482.1"
     atgcagccta aacctttact gataactctg gtgctgtcag ttcaagctac catcaccacc        60
     gtccccgcct atgctcaggt gtcctatgac gaccccgtga ttagcggcga tatcacctta       120
     ccgactacca ccgcacccac caccttccct gatgtgccca tccccacggg ggatgtgacg       180
     atagccaagg ataatcctct agatacggcc acctatacgg aagtacccac ggctcagctc       240
     cctagtggtc tcctcggcac ggtctttaat gtcctgggac ccaagcagaa acctggacaa       300
     gcgagggtga tcaatgagac tcaacgcaaa attctcaagg tctatgaata tggacagaaa       360
     gcgcttgatg cctacaaggt aggccgagcc atttatgacg caatcgataa cttctccctg       420
     aagcggatcc taagcgggtc cgtctcgtct atcctcgcca attacgacaa gttgggcacc       480
     aacggcacca gcgggagcca gcaaggaggc agtggatctg aggaccccat ttattcggat       540
     ccccaagacc cctttcaggt gtatacccaa gcccgcaaca acgaggcccg taaagcctta       600
     ctcccccaac tgatgactca gctcgtcttt tctgaagatg gtcaagcctt gattcagcag       660
     cagggagagc aggtgcagca gtccgtggtt aacaccattg agtccacaca agccctcgtg       720
     cagctcagtg ccgctagcaa agagcaagcc acagcggggg ctgggattgc gacctctgtt       780
     ggggagacgg gtcagaaagc ccaaaccctc aagtcctccc aagcagtcct caagtccctc       840
     accgctcaaa acagcctgat ggctcaagga accgcaacca atggagccat actgagcaac       900
     gtcgtatcgg gtcaagagga gcagaagaag tcctcagatg ccctcgtggt tggctctgcc       960
     cttgcccatc agcagcgcac gacggggctg cacttaagcg cctcagaact cactctccaa      1020
     gaacaaatcc gagctgaact ggagctatac aaagatgaac gacaccgtgc ccaagaccag      1080
     gctgctctgc gggagcagct tagcttcaac tacctctaca ttcctggctt atattcagag      1140
     accactccct ag                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page