(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE34

ACAM1_4.PE34         Location/Qualifiers
FT   CDS_pept        complement(34970..38116)
FT                   /locus_tag="AM1_C0034"
FT                   /gene_family="HOG000022990" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340489"
FT                   /db_xref="GeneID:5686256"
FT                   /translation="MDFEAVNEGQTRDILSVNTMLDGIPVFYLGASIAVLGVGFAVLIK
FT                   FGFLLAVLFIALTSIGIILIFGRNPSQQMERVGKPTTYMDGRPSLRFDNVGMPVMAKAK
FT                   KTDPLRRIQDNFCLKTYGQFEFEGVTVGFHLHHWNSREIKIAFMFDVLGLDPTVTPAQS
FT                   KQQLNKSNQKICHLGGTDLKAILDVRADCSDPLIATATALGKATDALTTAQLQSDAENL
FT                   QSLEAEGRIAKSRLLYQAKCRMRLGGDYDTPDSPADVVFEWVSGFWNDTVAQKVMGEAY
FT                   QSKEQWEKAIFAAYTNSYRRMTRMLTGAEGLGHKIQPLTAQELFDWDYAELHEESIPIP
FT                   QYTRYDDLGLDPNPVVSEHHLHSLGVLFEPEKGKPAVPQFGESLAYLPSKGKYVGALRF
FT                   EGLRTIPEVQDSTELGFIKFLFDTLATPGELFLDARVVTELLPIKSGLTRAILEQTGRN
FT                   SIRKMGDAAQRKELNPIALERLEETKKNLEWMNNGNRPFWIAFAIFLYRDSVDQLNLDL
FT                   DALAQKLEGTKAVKITQKFEHHWCTSLAISAAPMLTLPGGGNHLYKTMSPRVLPTLPQI
FT                   HPAPMDRRGVLLIGYDLPIPFYLDLAHTFPNHTLVTGETGAGKTMLMLEMTSYCQREGM
FT                   NVVGFDFPPPTGKSSYEPYMKTQEQLNVSSTYQPVDKATINVMETPDVSWIDDLPKPGE
FT                   PGYDYQQPTHEEAWKFIKRNKLRILKAIALGEAGQSSPMEDLLIERALGLCFDAFHQAN
FT                   LERYTKASIAPFGSAEAAQMPIYEEFVAFAKSWLNQYIQDNDCGPDLQRTFENLQLLLE
FT                   GVIPTALGDSINGISSFDANVDALMLGLTNVDNDSDSLVYGVAGFDLLIRKAMNGKRTL
FT                   LPVDEGSELLTRPIFAEMVGSLANSGRKWKCNILIGMTEVKTLLNSSCSSKVISNLQNK
FT                   LVSYVNKYARELLVSEFGFQAEILKKFEHDSFKASETLQQSHWCWQRGSRQLIVTHNPS
FT                   NFTLGVGSNQGKQTEARNRVMSRYPDDPVAGLVDFGDQLSQANKQGIEVETIGVEDHAA
FT                   "
FT                   /protein_id="YP_001521483.1"
     atggattttg aagccgttaa cgaaggtcaa acacgagata tcctctccgt gaatacgatg        60
     ctagacggta ttcccgtctt ttaccttgga gcatccatcg ctgttttggg ggtgggtttt       120
     gccgtcttaa tcaaatttgg gtttttgctg gccgtcctct tcatcgcctt gacgagcatc       180
     ggcatcattc ttatttttgg ccgcaatccc tcccagcaga tggagcgggt gggtaagccc       240
     acgacgtaca tggacggtcg cccgtcccta aggttcgaca acgtggggat gcccgttatg       300
     gcaaaggcca agaagacaga ccccctgaga cggattcaag ataacttctg ccttaagacc       360
     tatgggcagt ttgaatttga aggggtcacc gttgggttcc atctccatca ctggaatagt       420
     cgagagatca aaattgcgtt tatgtttgac gtgctgggtt tggacccgac cgtcaccccc       480
     gctcaatcca aacagcagct caataaaagt aatcagaaga tctgccatct cggtggcacc       540
     gacctcaaag caattttgga tgttagagca gactgctcag accctttgat tgccacggcc       600
     accgccctag ggaaggccac ggatgccctg accaccgctc aactgcaatc cgacgctgag       660
     aacctgcaat ctctagaagc tgagggtcgc atcgctaaat cccgcctcct ctaccaagct       720
     aaatgccgga tgcgtctcgg tggagactat gacaccccgg actctcccgc tgatgtggtg       780
     ttcgagtggg tatcgggctt ttggaatgac accgtggccc aaaaggtgat gggggaagcc       840
     taccaatcta aagagcagtg ggagaaagcc atctttgccg cctataccaa ctcctatagg       900
     cggatgacga ggatgctcac gggtgcagaa ggcttaggtc ataaaattca gcccctcacg       960
     gcccaagagc tatttgattg ggattacgcc gaactgcatg aagagagcat ccccatcccc      1020
     caatacactc gctatgacga cctgggctta gatcccaatc cagtagtcag tgagcatcac      1080
     ctccatagcc tgggggtcct gtttgaaccc gagaaaggga aacctgctgt tccccaattc      1140
     ggtgaaagcc tcgcctacct gccgagtaaa gggaagtatg tgggcgcact gcggtttgaa      1200
     ggactcagga ccatccccga ggtccaagac tccacggaat tgggatttat caaattcctg      1260
     tttgacaccc ttgccacccc tggagaactg ttcttagatg ctcgtgtggt caccgaactg      1320
     ctgcccatca aatccgggct gacccgagcc atcctggagc aaacggggcg gaactccatc      1380
     cgcaagatgg gggatgccgc ccagcgtaaa gaactgaacc ccattgcctt agaacgcctt      1440
     gaagaaacga agaaaaacct agagtggatg aacaacggca atcgtccctt ctggatcgcc      1500
     ttcgccatct tcctctatcg agattccgta gaccaactca accttgacct ggacgcctta      1560
     gcccagaagc tagaggggac caaagccgtc aagattaccc agaaattcga gcatcactgg      1620
     tgtacgagcc tcgccatcag tgccgccccc atgctcacct taccgggcgg ggggaatcac      1680
     ctgtataaaa ccatgtcccc gagagtgctg cccaccctgc cccaaatcca tcctgcccca      1740
     atggatcgtc ggggggtgtt gctcataggt tatgaccttc cgattccctt ctacctcgat      1800
     ctagcccata ccttccccaa tcacaccctc gtcacggggg aaacgggggc aggtaaaacc      1860
     atgctgatgc tggagatgac gagctattgc cagcgggaag ggatgaacgt cgtgggattt      1920
     gacttcccac cccccacggg taaatccagc tatgaacctt atatgaagac gcaagagcag      1980
     ctcaatgtgt cttccaccta tcagcctgtg gacaaagcca ccatcaacgt catggagacg      2040
     cccgatgtct cctggattga tgatctaccc aaaccgggtg aaccgggcta tgactatcag      2100
     caacccaccc atgaggaagc ctggaaattt atcaagcgca acaagcttcg catccttaag      2160
     gccattgcct tgggagaggc gggccagtcc agcccaatgg aggacttgct aattgagcgg      2220
     gccttgggtc tctgctttga tgcattccat caggccaact tagagcgcta tacgaaagct      2280
     tccatagctc cctttggctc tgctgaagcg gcacagatgc ccatttatga ggagtttgtc      2340
     gcctttgcca aaagttggct caaccagtac atccaagaca atgactgcgg cccagacttg      2400
     cagcggacct ttgagaacct gcagctgctc ctggagggtg tcatccccac ggcattaggc      2460
     gattccatca atggcatcag ctcctttgac gccaacgtgg atgccctgat gctgggcctg      2520
     accaacgtcg ataacgatag tgactccctc gtctatgggg tggcggggtt tgacctgctg      2580
     atccgcaaag ccatgaacgg caagcgcacc ctattacccg tggatgaagg gtcagagcta      2640
     ctcacccgtc ccatctttgc cgagatggtg gggtccctcg ctaactcagg ccgcaagtgg      2700
     aagtgcaaca tcctgattgg gatgacggaa gttaaaacct tactcaattc aagctgttca      2760
     tccaaggtca tttccaacct ccagaacaaa cttgtcagct acgtcaacaa gtatgcccgt      2820
     gagctgttgg tctcagaatt tggattccag gccgagatat taaagaagtt tgagcatgat      2880
     tccttcaaag catctgagac cctccagcag tcccactggt gctggcagcg ggggtctcgg      2940
     caactgattg tcacccataa ccccagcaac ttcaccttgg gggttggttc caaccaagga      3000
     aagcaaaccg aagcccgcaa ccgggtgatg tctcgctatc ctgatgaccc cgttgcggga      3060
     ttagtggact ttggtgatca gctctcccag gccaacaaac aagggattga ggttgaaacc      3120
     attggagtgg aagaccatgc agcctaa                                          3147
//

If you have problems or comments...

PBIL Back to PBIL home page