(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE35

ACAM1_4.PE35         Location/Qualifiers
FT   CDS_pept        complement(38129..38680)
FT                   /locus_tag="AM1_C0035"
FT                   /gene_family="HOG000022991" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340490"
FT                   /db_xref="GeneID:5686257"
FT                   /translation="MKRLKILYEKTSKQPWWFGYSGFLIIGLIYNLPWLQATSLACLAI
FT                   TASAIAWRRIIRRSPHVLAGLQTVSITIGYQQYAQAQLNVPDSVCNGFDVIPGFGKAMI
FT                   GGLGWLNVQGFSLAGAVCGIGWLILAGVVLGAIGFAGKNSLGHSHHGGDIQEMSRPVVG
FT                   LLYFIIVMIMIGALIFAATR"
FT                   /protein_id="YP_001521484.1"
     atgaaacgac tcaagatcct ttacgaaaaa acctcaaaac agccctggtg gtttggctat        60
     agtggctttc ttatcatcgg cctgatctac aatctgccct ggctacaagc gacctctctc       120
     gcctgtctcg ccatcacagc atcagccatc gcttggcgca gaattatccg cagatctccc       180
     catgtcctcg cgggcctgca aaccgtgagc atcaccatcg gctatcagca atatgcccaa       240
     gcgcaactga acgtacccga ttccgtctgt aatggcttcg acgttatccc aggttttggg       300
     aaggccatga ttgggggctt gggttggctg aatgtccaag ggttctcctt ggcgggagcc       360
     gtctgcggga ttggctggct gatcctcgcg ggtgtggttc tcggtgccat tggctttgcg       420
     ggtaagaaca gtttgggcca ctctcatcat ggtggggata ttcaagagat gtcccgcccc       480
     gtggtgggac tcctctactt catcatcgtc atgatcatga ttggtgccct gatttttgcg       540
     gcaacccgat aa                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page