(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE36

ACAM1_4.PE36         Location/Qualifiers
FT   CDS_pept        complement(38716..40809)
FT                   /locus_tag="AM1_C0036"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA polymerase sigma-2 subunit"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340491"
FT                   /db_xref="GeneID:5686258"
FT                   /translation="MTTTTIASPFSDGIRLPEYLVQFLHRFPIPDPEQELDLIRKAKRG
FT                   HETSLSWLMIGHVRLVAKLAKQYAWTLDDAQDLIQEGMLGIRHAVGKFDSTKGCKFSTY
FT                   ARGWIRGYIRRFCYKNRPKQLRLPEKKQVHLDRVYRLQNEFPDANLEEIARKANLKLEY
FT                   IEDLLYWGRSFQEIPDWHEFVIDDASFYTDDEEYDEYFDIELEPETKTNLVLIKAPPPF
FT                   IPPKYQIPIHLLKQWFRVGLAQFVNAAKDQLEHTRLGFSQSFSRSSPSTAPEVGQERVN
FT                   LNTWPAPLSFCYENSINPYAYSQAPPAIESLSAKAINLVKGVIAHAQESLLVLCGGRSD
FT                   GSTDRPGHQPSPADQRCRGLGEPGTTGRGHLGFCQAVTEFIHRPLATISDCLRGFPSRA
FT                   GPDTSQQPQRGAVFDSNPPPQQMHLPRKNAMYKTIAAMIAAWLGLLISPATAETIKIAP
FT                   GHGHLIDLTASGCRVSKAYMGTRGIFDLSLDRPQPQTQKIYLTWKPNTQVKSTNLIQDL
FT                   VGCNRSSMELTINRSDSAPSTAITRIGTPTPIAHTPEQSRVFTGRLGQPPERTRVHQAS
FT                   TAVQPLTLKPQAQTLPKPKIVKRPPVRRVPLTQKVKPIPTANIPLTKTNVSDSRITPAT
FT                   LLRGLNIARASGNQTYSYLSEMHWRVNGMIRQMRWGAKADVAAKRAKISPDQLQTLLNY
FT                   AQQ"
FT                   /protein_id="YP_001521485.1"
     atgacgacca ctacgattgc tagccccttc tcagacggaa tccgtctacc cgaatatctc        60
     gttcagttct tgcaccgctt ccccatccca gacccagagc aagagctaga cctgatccgc       120
     aaagctaagc gaggccatga gacctctttg tcatggctga tgatcgggca tgttcgcttg       180
     gtggcgaaac tcgccaaaca atacgcatgg actttggatg atgctcaaga cctgatccaa       240
     gaggggatgt taggcatccg tcatgccgtg gggaaattcg actctacgaa aggatgcaag       300
     ttctccacct atgcaagagg ctggattcgc ggatatatcc gtagattctg ctataaaaac       360
     agacccaagc aattgagatt gcccgagaaa aaacaagtcc atctcgatag ggtttacaga       420
     ctccaaaacg agtttcctga tgccaacctg gaagagattg cccgaaaagc gaacctaaag       480
     ctggaatata tcgaggattt actctattgg ggccgttcat ttcaagaaat cccagactgg       540
     catgaatttg tgattgatga tgcgtcattc tacacggatg atgaagaata tgacgagtat       600
     tttgatattg agcttgaacc tgagacaaag acaaatctcg tcctaatcaa agcacctcca       660
     cctttcattc caccgaagta tcaaatccca atccatctcc tcaagcagtg gttccgggtt       720
     ggcttggcgc agttcgtgaa tgcagccaaa gaccaactgg aacatactcg actaggattt       780
     tcccaaagtt tcagcagatc ctccccatca acagcaccag aagtaggtca ggaacgagta       840
     aacctcaata cctggcctgc tcctctttcc ttctgctacg aaaacagcat taatccttac       900
     gcttattccc aggctccccc tgctatagag tctctttctg ctaaagctat caacttagtc       960
     aaaggagtta ttgcccatgc tcaggaatct cttttggttc tttgtggggg tcgcagtgac      1020
     gggtctactg atcgaccggg gcatcaacct tccccagcgg atcagcgatg ccgtggactg      1080
     ggagagcctg gaacgactgg gcgaggacat ctgggattct gccaagcagt aaccgagttt      1140
     attcacagac cattagcgac gatatctgat tgccttagag gatttccatc acgggctggc      1200
     cctgacacca gccaacaacc acagcgagga gctgtctttg atagcaaccc tccaccccag      1260
     cagatgcact tgccaaggaa aaacgccatg tacaaaacca ttgccgccat gatcgcggcc      1320
     tggttggggc tgctcatctc cccagccaca gcggaaacca ttaagatagc gcccggtcat      1380
     ggtcacctga ttgaccttac cgcaagcggg tgccgggtct ccaaagccta tatgggtacg      1440
     aggggaatct ttgacctgag cttggatcgg ccccaacccc aaacccagaa gatttacctg      1500
     acttggaaac ccaataccca ggtgaaatcg acgaacttaa tccaagattt agtgggctgc      1560
     aaccgctcct caatggagtt aacgatcaat cggtctgaca gtgcccccag tactgccatc      1620
     actcggattg gaacacccac ccccattgct cataccccag agcaatcgcg agtcttcaca      1680
     ggtcgcctgg gtcaaccacc tgagaggact cgcgttcatc aagcttcgac agcggtccag      1740
     cctttgacct taaagcccca ggctcagaca cttcccaaac cgaagatcgt caaacgtcct      1800
     cctgtgcgac gagtccccct aactcagaag gtaaagccta tcccaacggc taacataccc      1860
     ctgactaaaa ctaatgtgtc cgatagccgt atcactccag cgaccctttt gaggggtcta      1920
     aacatcgcta gagcgtcagg caaccagacg tatagctatc tctcggaaat gcattggcga      1980
     gttaacggca tgattcgcca gatgcgttgg ggagcaaagg ctgatgtggc agcaaagcgg      2040
     gccaaaatct ctcctgacca acttcagacc ctgctcaact acgcccagca ataa            2094
//

If you have problems or comments...

PBIL Back to PBIL home page