(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE37

ACAM1_4.PE37         Location/Qualifiers
FT   CDS_pept        complement(40843..41013)
FT                   /locus_tag="AM1_C0037"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340492"
FT                   /db_xref="GeneID:5686259"
FT                   /translation="MTDRNSSDHNLQPNPILSHAQIWGKTGHGKVALAISDEHSPTPSH
FT                   LKINFHPKPSR"
FT                   /protein_id="YP_001521486.1"
     atgaccgaca ggaactcttc agaccataac cttcagccaa acccaatcct tagccatgcc        60
     cagatatggg gcaaaacggg gcatggcaag gtcgctcttg caatctcaga cgaacactcc       120
     ccaacaccca gccacctcaa gattaacttc catcccaaac cctctcgcta a                171
//

If you have problems or comments...

PBIL Back to PBIL home page