(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE38

ACAM1_4.PE38         Location/Qualifiers
FT   CDS_pept        complement(41050..42276)
FT                   /locus_tag="AM1_C0038"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340493"
FT                   /db_xref="GeneID:5686260"
FT                   /translation="MQVAIAKIGDATLLVTPDGKPVPHKDTEQPTFHIQPQLFNPYCDI
FT                   GLSDISLVGATIAPHDSTKPVSVLPKDVTIRQPYPNENYYVAGMAERKMGWDIPLDLDA
FT                   APKWLDLTWEVRTPSDIEHSILTIYHRFTLEFILTQQGQVFSMDQANTFYDPNARTISH
FT                   ISLNHIDDSFTKGDKSFKSYRMDSPHGLAFYQTLILNSCAWSDLICTAQEDVTLLRDIE
FT                   PAQSFQTHIDLHRQNACIEIPADVLHQAICDTQVEVDFEIGEYDRSPGLQRLCRWWNEN
FT                   APVVGTRRAAFIALWCRVEDDDWYWSGWDECPEWGVENIQRYGLQDRCARWNDFVILEF
FT                   FPRQVSRLEVAQGASTEILGVDGKGYTDTGLAREDVDEAYHAHYSLQAFPKRFPFAWKT
FT                   LQAAVHTPA"
FT                   /protein_id="YP_001521487.1"
     atgcaagttg cgatcgcaaa aatcggagat gcaactctcc tcgtcacccc ggacggtaag        60
     cccgtacctc acaaggatac cgaacaaccc accttccata tccaacctca actgtttaat       120
     ccttattgcg atatcggtct gagtgatatt tccctggttg gagccactat cgctccccat       180
     gattccacta aacctgtctc agtcttaccc aaagacgtaa cgattcgaca gccctatccc       240
     aacgaaaact attacgtcgc ggggatggct gagcggaaga tgggctggga tattccattg       300
     gatttggatg cggcccctaa gtggttggat ctgacttggg aggtacgaac accttcagac       360
     atagaacact caattttgac gatctatcat cgatttactt tagagttcat ccttacccaa       420
     caaggccaag tattctcaat ggatcaggcc aatacttttt atgatccgaa tgcccgtacc       480
     atcagccata tcagtctcaa tcatatcgac gacagcttta ccaaaggcga caagtccttt       540
     aagtcctatc ggatggattc ccctcacggc ttggcattct accagacctt gatcctcaac       600
     tcttgtgcct ggtcagacct gatctgcacc gcccaggagg acgttacctt attgcgggat       660
     attgaacctg ctcaaagctt ccaaactcac attgacctac atcgccagaa tgcttgcatt       720
     gaaattccag cggatgttct ccatcaagct atctgtgaca cccaggttga ggtcgatttt       780
     gagatcggag agtatgaccg ttctccaggt cttcaacggc tttgtcgctg gtggaacgag       840
     aatgctcccg ttgtaggaac ccgcagagct gcctttattg cgctgtggtg tcgtgtagaa       900
     gatgacgatt ggtattggtc cggttgggac gagtgcccgg aatggggtgt ggagaatatt       960
     cagcggtatg gccttcaaga ccgctgcgcc cgatggaacg attttgtaat tctggagttt      1020
     ttcccacgcc aggtgagccg attggaggtt gcccaaggag cctcgaccga aattctaggc      1080
     gtagatggca agggctatac cgatacgggc ttggcgcgtg aggacgttga cgaagcctat      1140
     cacgcccact attcactcca agctttcccc aagcgattcc cctttgcctg gaagacgcta      1200
     caagccgcag ttcatacccc tgcataa                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page