(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE39

ACAM1_4.PE39         Location/Qualifiers
FT   CDS_pept        complement(42364..42804)
FT                   /locus_tag="AM1_C0039"
FT                   /gene_family="HOG000022992" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340494"
FT                   /db_xref="GeneID:5686261"
FT                   /translation="MLTINTDSGKSRGGSNDLQNSDQLDPQVIQEYRERYLQIAWKVQG
FT                   LMSMPVLYTYDQLYRHGCDHPKLSERIDALVSLELRLSGYSKDDQVNILLYGPYIQAQM
FT                   LDHSMSESGARDYIRQRLAIAPTPPAPLKELSQIQVAPTTAA"
FT                   /protein_id="YP_001521488.1"
     atgctaacta taaatactga ttccgggaaa tcccgtggag gcagcaacga cctccaaaac        60
     tctgatcagc ttgatccaca ggtgattcag gaatatcgag agagatacct tcaaattgcc       120
     tggaaggttc aaggcttaat gtcgatgccc gttctatata cctacgacca gctttatagg       180
     cacggttgcg atcacccgaa attaagtgag cgaattgatg ctcttgtgag cttggagctg       240
     cggttgagtg ggtattccaa agatgatcag gtgaatatcc ttctttatgg tccctatatt       300
     caggcgcaga tgctggatca cagtatgtct gaaagtgggg ccagggatta tatccgtcag       360
     cgattagcca ttgctccaac cccacccgca cccttgaagg aattgagcca aattcaagta       420
     gctccgacaa ctgctgctta g                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page