(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE40

ACAM1_4.PE40         Location/Qualifiers
FT   CDS_pept        complement(43387..46911)
FT                   /locus_tag="AM1_C0040"
FT                   /gene_family="HOG000023186" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340495"
FT                   /db_xref="GeneID:5686262"
FT                   /translation="MSSFQNISSKLLATNRSNPCDLCGDITGKCRKAGNLNLCMTLSGK
FT                   IEGYRYLGQSKDGLWGKYVLDDGEDLSQEDWERRWQEQRILREQRAQVEAQRHAQSLPA
FT                   IERDRLYRQLLDQLTLHPADRADLHRRGFTNEQIQDWGVKSVEQWQPLSGELPHDLPGI
FT                   NLDGKSLNTPRPGYLCPIMDADGQIVGFQIRSRSSEGGRYFWLTGKTRKRPNGPTPHLR
FT                   NGELPLAIHRPEQITRDAFALVEGTGAKPHLLAQRMGQVTIGAAGGLFAASPETLKATL
FT                   AQLGITTIEFYPDAGAIQNKSVLRQYRSTWALLKEWGYTVTVAWWKQTDKRIHTDIDEL
FT                   DDLSQIQYLSVADFERIAAQCNGLLHQLQQALSKLTRPSSPAQGFATPNDQQTHPTESR
FT                   RTKRTAPDEERLATLPATSRRARRSRRRTARLLAAHRRHGYISKLRLENYRSRIRRRTA
FT                   QSANSRSSSLQSCPGDNGTLSPTTPLVHEYQPGQRLQTWETLISSGFPYILDQSQPGTG
FT                   KSYDSGNVTPIGFGMEQVIYLSDQHRNPTVSTLEQGNGWCDLEARHGGLNRVKNRLQRS
FT                   AKGDAFAVPANCSRIGVLNALRDKNIPGADTANLICGTCIAREACINADGPGYGFLNQR
FT                   RNVLGTPLLRAHPDSLPDPEDYPLENTMLIWDEPGQNFQVKQSVTVTFNDLQQTISGLI
FT                   AYPEIFALVQPLLSALLPLMDGSEKLGKYGLNHLEMKAKLPDMAGVKLGELTQVLMPNL
FT                   GFLNTTSDYGVDLADLPKQLRKKFSERDSEMAEQARNGVVKQWLIPLIRILQGGAGCIQ
FT                   VSRYGLLTLNTPNPRHRDLAQAAQANVFLDATLSREDLALKLGCSPDEILVVRQAVPDT
FT                   GNLEVIQVKDMGRVGMSRGGDQTKRIGALAQHYQDLDAVNTRTIDFKKFEKDGAWWRDS
FT                   RGVNDFLTVQTLVLVGTPCRNLNDLAAEFAIVCGYYPEEDNPAFTAFIDRSILAEIHQA
FT                   IGRLRAHRRPHESLQVVLISNIEMDCFVQEVQAKELTLDAAHKTERVEIAIESAILQLQ
FT                   AKGEKVTQQIVSAMTQIPRGTIARYWRLFISLLKGLNSKMNNLCNAPNPNQETHQAIAG
FT                   VLDELADLPVNDLLPSLNEVFFDWLKPKEWSSVWSEVSASGQMAILEGLAMTLPVKMLE
FT                   RGMPELAA"
FT                   /protein_id="YP_001521489.1"
     atgtctagct ttcaaaatat ttcgagtaaa ttgcttgcaa ccaaccgctc caacccctgc        60
     gatctctgcg gggatatcac aggcaaatgt agaaaggcag gcaacctcaa tctctgcatg       120
     accctttcag gcaagatcga gggatatcgc tacctcggcc aatccaaaga tggcctctgg       180
     ggtaaatacg tccttgatga cggggaagac cttagccagg aagactggga acgccgatgg       240
     caagagcaac gaattctcag agagcaacgt gcccaagttg aggctcaacg ccatgcccaa       300
     tcgctccccg caattgaacg ggatcggcta tatcgccaac tccttgacca gctcaccttg       360
     cacccagcag atcgggcaga cttgcatcgt cgaggattca ccaatgagca aatccaagac       420
     tggggagtta agtcagtcga acagtggcaa ccgctctctg gtgaactacc ccatgacttg       480
     ccaggaataa acctggatgg gaagtctctc aacaccccaa ggccaggtta cctttgcccc       540
     atcatggatg ctgacggtca gatcgtcgga ttccaaatca gatcccgcag ttccgagggt       600
     ggtcgctatt tctggctcac aggcaaaact aggaaacggc ccaacggacc cacaccccac       660
     cttcgcaatg gtgaattacc cctagccatc caccgtccag agcaaatcac gagagatgca       720
     ttcgcactcg ttgaaggtac tggagcaaaa cctcacctcc tagctcagcg catgggccaa       780
     gtgaccatcg gcgcagcggg gggattgttc gcggcatccc ctgaaacctt gaaagcaacc       840
     ctagcccagc ttgggataac aactatcgag ttctaccccg atgctggggc gattcagaac       900
     aagtcagtac tgcggcaata ccggtcaacc tgggcgctgc tgaaggagtg gggttacact       960
     gtcaccgttg cctggtggaa gcagacagac aaacgcatcc acactgacat tgatgaactg      1020
     gatgacctaa gccagattca atatttgtct gtggctgact ttgaacggat tgcagctcaa      1080
     tgtaatgggc tattgcatca gcttcagcag gcactctcaa aactcactcg tccttcatcg      1140
     cccgctcaag ggtttgccac tcccaatgac caacaaaccc accccactga atctcgcaga      1200
     acgaagcgaa ctgcaccaga tgaagagcgt cttgcaacgc tgcctgcaac aagccgtcga      1260
     gctagacgat cccgtcgtcg cactgcacga ctccttgcag ctcatcgtag acatggatat      1320
     atttcaaaac ttcgactgga aaattatcga agtcgcatta gaagacgtac agcacaatca      1380
     gcaaactcca gaagcagcag cttacaaagc tgccctggag ataacgggac tctcagcccg      1440
     acaacacctc tagtccacga ataccaaccc ggacaacgac tccaaacttg ggaaaccctc      1500
     atctcatcag gattccccta tatcctcgat cagtcccaac cgggtactgg gaaaagctac      1560
     gactctggga acgttacccc gattggcttt gggatggagc aggttattta tctttcagac      1620
     cagcaccgca atcccaccgt atcaacttta gaacaaggaa atggctggtg tgacctagaa      1680
     gcgagacatg gaggactcaa ccgggtcaaa aatcgactcc aacgatctgc caaaggggat      1740
     gccttcgctg ttcctgctaa ctgtagccgc attggagtct tgaatgccct gcgagacaag      1800
     aacatccctg gtgctgatac cgccaatctc atctgtggca cctgcattgc cagagaagcc      1860
     tgtatcaatg cggatgggcc aggatacggg ttcttgaatc agcggcgaaa tgtcttgggt      1920
     acaccactgt tgagggcaca tcccgactca ctaccagacc cagaggatta ccccttagag      1980
     aacacgatgc tgatctggga tgagccaggg caaaacttcc aggtcaagca gtccgtgacc      2040
     gtcaccttca atgacttaca gcaaaccatt tcaggtctga ttgcctaccc tgagatcttt      2100
     gccctagtgc agcccttact ctctgcgctg ctgcccttaa tggatgggtc tgagaagctg      2160
     ggaaagtatg gcctcaatca cttggagatg aaagccaagc tccctgacat ggctggagtg      2220
     aagctaggcg aactgaccca agtcctgatg cctaacctgg gctttctcaa caccacctca      2280
     gactatgggg tggatcttgc tgatctaccc aagcaacttc gcaaaaagtt ctctgagcga      2340
     gactcggaga tggctgagca ggctaggaat ggagtggtta agcagtggct catcccccta      2400
     atccgcatct tgcagggtgg agcaggatgt atccaagtca gtcgctatgg ccttttaact      2460
     ctcaatactc ccaaccctcg ccatcgagac ttagctcaag ctgcccaagc caatgtgttc      2520
     ctcgatgcca ctctatcccg tgaagacctg gcgctgaagc tgggctgctc tcctgatgaa      2580
     atcctagtgg tgcgccaagc tgtcccagac accggaaacc tagaggtgat tcaggtgaag      2640
     gacatggggc gagtgggcat gagtagaggc ggggatcaga ccaagcgtat tggggccttg      2700
     gcccagcatt accaagattt ggatgcagtg aatacccgaa cgattgactt caagaagttt      2760
     gaaaaggatg gggcctggtg gcgcgatagc cgaggggtca atgatttcct caccgtccag      2820
     actctagtcc ttgtcggcac tccctgccgc aatctcaatg acttggctgc tgaattcgcc      2880
     attgtctgtg gatattatcc agaagaggat aatccagcat tcacggcatt tattgaccgc      2940
     tccatcctcg cagaaattca ccaagccatc gggcgactga gggcacatcg gcgtccgcat      3000
     gaatccctac aagtggtact gatttccaac attgagatgg actgcttcgt tcaggaagtc      3060
     caagctaagg aacttaccct ggatgctgct cataaaacag agcgagtaga aatcgccatt      3120
     gagtcggcca ttctccaact ccaagccaaa ggcgagaagg tcactcagca aatcgtttca      3180
     gcaatgaccc aaatccccag agggacgatt gcgcgatact ggcgtctgtt catttcgcta      3240
     ttaaaaggtt taaatagcaa aatgaacaat ctatgcaacg cgccaaatcc aaaccaagag      3300
     acccatcaag cgattgcggg tgttttggat gaactggcgg atctacccgt caatgaccta      3360
     ttgccgagcc taaatgaagt attctttgac tggctcaagc ccaaggaatg gagttcggta      3420
     tggagtgaag tcagtgcatc gggccagatg gcgattctgg aggggttagc aatgacgctg      3480
     cctgtgaaga tgttggagag aggaatgcca gagctggcgg cataa                      3525
//

If you have problems or comments...

PBIL Back to PBIL home page