(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE41

ACAM1_4.PE41         Location/Qualifiers
FT   CDS_pept        complement(47591..48616)
FT                   /locus_tag="AM1_C0041"
FT                   /gene_family="HOG000022994" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340496"
FT                   /db_xref="GeneID:5686263"
FT                   /translation="MDGGTQPRAQLFEEVVAEYAEDMKQGAIFPPVIVYYDGEEYWLAD
FT                   GFHRVRARETIGSKDVTADVRLGTQRDAVLYAVGANAAHGLRRTNADKHRAVKRLLRDK
FT                   EWMKWSDREIARRCGVANSFVGRIRKSLSVPEEQINHDAEGLDLDPSVRLAKRGGTIFE
FT                   MDTTNIRDRPQTEQKKSIKRSRAKKQPVSPKPLEGKPIEVKEGDTWKLGKSHYLFCGEG
FT                   SSRKFLKLFPPEVALLLYFPRQREDWTQAITLQARSTLLFHTFYGEDIDLKNLRKIIEN
FT                   CLSTTTDADDSIVVINLADPLLFILMESLFCSCYCAEPDPQRCTDALAAWAAIKQPVKK
FT                   L"
FT                   /protein_id="YP_001521490.1"
     atggatggcg gtacccaacc tcgcgctcaa ttatttgaag aagtggttgc tgaatatgct        60
     gaagacatga agcaaggtgc aattttccct ccagttatcg tctattacga tggagaagag       120
     tattggttag ctgatggttt ccatagagta cgcgctagag aaaccatagg atcaaaagat       180
     gtaactgctg atgtgcgtct cggaacacag cgagatgctg tcctatacgc agttggagct       240
     aatgcagcgc atggacttcg aagaacaaat gcagacaagc atcgggctgt taaaaggtta       300
     cttcgtgata aggaatggat gaaatggagt gatcgagaaa tagcgaggcg ttgtggagtc       360
     gcaaacagtt ttgttggacg tatccgtaaa agtctatccg ttcctgaaga acagataaac       420
     catgacgcag aaggactaga tttagaccct tccgtacgcc tggcgaaaag aggtggaact       480
     attttcgaga tggacacaac aaatatccgc gatagacctc aaactgaaca gaagaagtct       540
     attaagcgct cacgagcaaa gaaacaacct gtttctccta agccccttga gggaaaaccc       600
     atagaagtta aagaggggga tacctggaaa ctaggtaaat ctcattactt gttttgcggg       660
     gaaggttcat ctaggaagtt tctaaaactt ttcccacctg aagtagcatt acttctatat       720
     tttccacggc agagagaaga ttggacacag gccataacgc tacaagctag aagtacgctg       780
     ctatttcaca ccttctacgg agaagatata gatctaaaaa atctgagaaa aattattgaa       840
     aactgtcttt ccactacaac ggatgccgat gattccatag tagttatcaa tcttgcagat       900
     cctttgctct ttatcttaat ggagagttta ttctgctcct gttactgtgc tgagccagat       960
     cctcagcgat gcacagacgc tctcgctgct tgggccgcaa tcaagcaacc agtgaaaaag      1020
     ctataa                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page