(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE42

ACAM1_4.PE42         Location/Qualifiers
FT   CDS_pept        complement(48768..49229)
FT                   /locus_tag="AM1_C0042"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340497"
FT                   /db_xref="GeneID:5686264"
FT                   /translation="MSYSKVDNSFTNLKLSDITLDNEIQSYQQLIQEVVGEFAEAMRQG
FT                   AKFPPVVVFFDGDNYWLADGLHRFLAKQFVAEQSISTEVQPGSRYDANFYSARSNLNPS
FT                   DIHSSEEKHRFFENILYDGQSEPLQYLDQSPNRSRRKRGQTIATNIRTL"
FT                   /protein_id="YP_001521491.1"
     atgagctatt caaaagttga taattcattc accaatctga aactatcaga tataactctt        60
     gataatgaaa tacaatctta tcaacaactg attcaagagg ttgttggtga atttgctgag       120
     gcaatgaggc aaggggctaa gtttccacca gtggttgttt tttttgatgg cgataattac       180
     tggttagcgg atggattgca tcgatttctg gctaagcagt ttgtagctga acaaagtatt       240
     tcgactgagg tgcagcctgg ttctcgttac gatgcaaatt tttactcagc acgttccaat       300
     ttgaatccta gtgatataca tagcagtgaa gaaaaacaca gattttttga gaacatcttg       360
     tatgatggcc aaagtgagcc tctacaatac ttggaccaat caccaaatcg ctctagaagg       420
     aagagaggac agactattgc aacaaatata cggacacttt ag                          462
//

If you have problems or comments...

PBIL Back to PBIL home page