(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE43

ACAM1_4.PE43         Location/Qualifiers
FT   CDS_pept        49780..50832
FT                   /locus_tag="AM1_C0043"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340498"
FT                   /db_xref="GeneID:5686265"
FT                   /translation="MDKEWDLQRLYSDLEMVNKQSLSNSAKQYLEYILLGQSPSNIAET
FT                   LNPESRQSSGTIRTVLSRDVYPSLILLLNLPEDYRMRWNKVPMLLSQYKIAKREACSSS
FT                   PSYIHYEKNQNSYVGSCQIKSDIINGLLKKYFLKKGFTEDFLSSNTKSMSFRSEWQTIV
FT                   NKLVSETRETLLAMVLDTELKKWWSSIAGMMYMATNVNLLKNGVKIKRIFILNSLDFRI
FT                   RNNAIMNAYLHEKMGVEVKILDNIDCKIKMFIDADMISVHDKELIALYYLSEDCEITEL
FT                   LLDYCSISAFSSFYDELFDDDRLCENVDKIISNSNLSSSFFSDIEHQINYLKRISCSTS
FT                   VKEFLGILPN"
FT                   /protein_id="YP_001521492.1"
     ATGGATAAAG AGTGGGATCT TCAAAGATTG TACTCTGATT TAGAGATGGT GAATAAACAG        60
     AGCTTGTCAA ATAGTGCCAA GCAATACTTA GAATACATTT TGTTGGGTCA ATCTCCATCG       120
     AATATTGCTG AAACTTTAAA TCCTGAAAGC AGACAATCAT CAGGGACTAT TAGAACGGTT       180
     TTATCAAGAG ATGTTTATCC TAGTTTAATT TTATTATTAA ACCTGCCAGA AGATTATAGA       240
     ATGCGCTGGA ACAAAGTTCC AATGTTGCTA AGTCAGTATA AAATCGCAAA GAGAGAAGCT       300
     TGTTCATCAT CGCCTTCTTA TATTCACTAT GAAAAGAATC AGAATAGCTA TGTTGGCTCC       360
     TGCCAGATCA AGTCAGATAT TATAAATGGG CTTCTAAAAA AGTATTTTCT AAAAAAGGGT       420
     TTCACTGAAG ATTTTCTCAG CTCTAACACA AAAAGTATGA GTTTTAGAAG TGAGTGGCAA       480
     ACAATTGTTA ATAAGCTTGT GAGTGAAACA AGAGAAACTT TACTAGCGAT GGTCTTAGAT       540
     ACTGAACTAA AGAAATGGTG GTCATCAATC GCAGGAATGA TGTATATGGC AACTAATGTC       600
     AATCTACTAA AAAATGGGGT TAAAATTAAA CGAATATTTA TATTAAACTC ATTAGACTTT       660
     AGGATAAGAA ATAATGCTAT TATGAATGCA TATTTGCATG AAAAGATGGG AGTCGAAGTT       720
     AAAATTCTAG ACAATATTGA TTGCAAAATT AAAATGTTTA TCGATGCAGA TATGATATCT       780
     GTACATGATA AAGAATTGAT AGCTTTATAT TATCTTTCTG AAGATTGTGA GATTACGGAA       840
     CTTCTTTTAG ACTATTGTTC TATTTCAGCC TTTAGCTCTT TCTATGATGA ATTATTTGAT       900
     GATGATAGAT TGTGTGAAAA TGTTGATAAA ATAATATCAA ATAGCAATTT GAGTAGCTCC       960
     TTCTTTTCTG ATATTGAACA TCAAATCAAT TACTTAAAGA GAATTAGTTG CTCAACATCT      1020
     GTTAAAGAAT TTCTTGGTAT ATTGCCTAAT TGA                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page