(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE44

ACAM1_4.PE44         Location/Qualifiers
FT   CDS_pept        50837..51295
FT                   /locus_tag="AM1_C0044"
FT                   /gene_family="HOG000014565" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340499"
FT                   /db_xref="GeneID:5686266"
FT                   /translation="MKSTELKTGRTFGVTFEHQSDFFQELSSFCKENQVQQGYIPMFIA
FT                   GFSEVELVGTCSKIDDVNAPVWDKVHLSNVEACGCGTIAYDSDEDKISPHIHVNTGIKS
FT                   YSASGHTSHLLSAKVLFLVEMLIVEVLQPDMRRVVDPNLYNIGLLQFI"
FT                   /protein_id="YP_001521493.1"
     ATGAAAAGTA CTGAATTAAA AACAGGAAGA ACTTTTGGTG TTACTTTTGA ACATCAATCA        60
     GATTTTTTTC AAGAGCTTTC AAGCTTTTGT AAAGAGAATC AAGTACAGCA AGGATATATC       120
     CCCATGTTTA TTGCTGGATT CTCCGAAGTA GAATTAGTGG GAACTTGCAG CAAAATTGAT       180
     GATGTCAATG CTCCAGTATG GGATAAGGTA CACTTAAGCA ATGTAGAAGC TTGTGGATGT       240
     GGTACTATTG CCTATGATTC TGACGAAGAT AAAATATCTC CACATATTCA TGTTAATACT       300
     GGTATAAAAA GTTATTCTGC TTCTGGACAT ACCAGTCATT TATTAAGTGC TAAGGTTCTT       360
     TTTTTGGTTG AAATGCTTAT TGTAGAAGTT CTACAACCTG ACATGAGAAG AGTTGTTGAT       420
     CCAAATTTAT ATAATATTGG ATTACTTCAG TTTATTTAA                              459
//

If you have problems or comments...

PBIL Back to PBIL home page