(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE45

ACAM1_4.PE45         Location/Qualifiers
FT   CDS_pept        51334..52143
FT                   /locus_tag="AM1_C0045"
FT                   /gene_family="HOG000222700" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="carbon-nitrogen hydrolase family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340500"
FT                   /db_xref="GeneID:5686267"
FT                   /translation="MKVGFIQFSPILGKPTQTLERLEYLIDKGKHSDILVLPELCNSGY
FT                   AFNSRQQALNSSESVADSKFIRFLHEKSNKYNLYIVSGFCEKSDKDLYNSSFLVGPNEY
FT                   IEVYRKSHLFLNEKDFFSPGNTDYSVYDIGICKIGMLICFDWVFPEAWRILALKGADII
FT                   CHPSNIVLPDLCQKTIPGHSICNRMFIVTANRIGTEDNLTFTGSSIICDPRGNILTQAS
FT                   DDQEEVMISDIDLNLARDKSITSRNHIFLDRRPDKYLDIAKAIEESV"
FT                   /protein_id="YP_001521494.1"
     ATGAAAGTAG GTTTTATTCA ATTCTCACCT ATTCTCGGTA AGCCAACTCA AACTTTAGAA        60
     CGACTAGAAT ACTTAATTGA TAAAGGTAAA CATTCAGATA TTCTTGTGCT GCCAGAATTG       120
     TGTAATTCTG GATATGCCTT TAATTCTAGG CAACAAGCTC TAAATTCAAG TGAATCTGTC       180
     GCTGATAGTA AATTTATTCG TTTTCTTCAC GAAAAGTCAA ATAAATATAA TCTATATATC       240
     GTGTCAGGTT TTTGTGAAAA ATCTGACAAG GATTTGTATA ATTCTTCTTT TCTAGTTGGA       300
     CCAAATGAAT ATATAGAAGT TTATAGGAAG TCACATCTTT TTCTGAATGA AAAAGATTTT       360
     TTTTCTCCTG GGAATACAGA TTATTCTGTC TATGACATTG GTATCTGTAA AATAGGGATG       420
     TTGATTTGTT TTGATTGGGT GTTCCCTGAA GCATGGAGAA TCTTAGCTCT TAAAGGTGCT       480
     GATATTATTT GTCATCCCTC TAATATTGTT CTACCTGATT TGTGCCAAAA GACCATACCT       540
     GGCCACTCTA TATGCAATCG AATGTTCATC GTAACAGCTA ACCGTATAGG CACTGAGGAT       600
     AATCTTACGT TTACAGGTAG TTCAATTATT TGTGACCCTA GAGGTAATAT TCTGACCCAA       660
     GCTTCGGATG ATCAAGAAGA AGTAATGATT TCAGACATTG ATTTGAATTT AGCTAGGGAT       720
     AAATCAATTA CATCTAGGAA TCATATCTTT CTTGATAGAC GGCCAGATAA GTATTTGGAT       780
     ATAGCGAAAG CAATTGAAGA ATCAGTATAG                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page