(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE46

ACAM1_4.PE46         Location/Qualifiers
FT   CDS_pept        complement(52244..52558)
FT                   /locus_tag="AM1_C0046"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="single-stranded DNA-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340501"
FT                   /db_xref="GeneID:5686268"
FT                   /translation="MNTCTFQGILLERSLRYTQERRAIAEFVVEINPLMEEDPKENLKA
FT                   IYWGENGEQAHNALQAGDQLVLQGQLRINKVTHRLGNEEYVEQQASVIVEKINRIQSPG
FT                   "
FT                   /protein_id="YP_001521495.1"
     atgaacactt gtactttcca aggaatactc ctagagagat ccctgcgata tacccaggaa        60
     agacgtgcga tcgctgagtt tgttgttgaa attaaccctc tgatggaaga agaccccaag       120
     gaaaatctca aggctatcta ttggggagag aatggggagc aagcacacaa tgcattacaa       180
     gctggcgacc aactcgtttt gcaaggtcaa ctgaggataa acaaggtgac tcataggttg       240
     ggtaatgagg aatatgtgga acagcaagct agcgtgattg tcgagaagat taaccgaatt       300
     cagagtccag gttga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page