(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE47

ACAM1_4.PE47         Location/Qualifiers
FT   CDS_pept        52684..53505
FT                   /locus_tag="AM1_C0047"
FT                   /gene_family="HOG000022995" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340502"
FT                   /db_xref="GeneID:5686269"
FT                   /translation="MPSATIDKLNQLKVQLKQCNNDTAALLLKRTIAKLESQLQREQLT
FT                   TQSAKIPSKEIPKVSQAIFKQQSLVQDKKVVPQQQQITKNLQAKSKQRNHRKKRRPLLP
FT                   GNGTHRAWCRIPGIIRVQEVEGEGEQPVYFIELDGHQLPLRVKKRFSKLIGASLDTPLM
FT                   VKCYPQIIEGQIVFLQFCGAAEPTPETPEDWVMIGVWNSENQRVLVQRDQRCDQSRRIL
FT                   QHSPLVKEACLEKLEAGKLYRYQCQREGITVTIVGVEVVEGEEGKIVQEAS"
FT                   /protein_id="YP_001521496.1"
     ATGCCCTCAG CAACTATCGA CAAGCTCAAC CAACTCAAAG TTCAGCTTAA GCAGTGCAAC        60
     AATGACACTG CTGCTCTACT CCTAAAACGG ACGATTGCAA AACTCGAATC TCAACTCCAG       120
     AGAGAGCAGC TTACAACACA GTCTGCCAAA ATACCCTCAA AAGAAATACC AAAGGTCTCT       180
     CAGGCTATTT TCAAACAACA ATCTTTAGTC CAGGATAAGA AAGTAGTACC TCAACAACAG       240
     CAGATTACAA AGAATCTTCA GGCAAAATCC AAGCAGCGAA ACCATCGCAA AAAGAGACGG       300
     CCTCTGCTCC CTGGCAATGG CACACATCGC GCCTGGTGCA GGATTCCAGG AATCATCCGA       360
     GTTCAGGAAG TGGAAGGTGA GGGAGAACAG CCAGTATATT TCATAGAACT GGATGGTCAT       420
     CAGCTCCCTT TGAGGGTAAA GAAGCGCTTC AGCAAATTGA TAGGAGCGTC ATTGGATACT       480
     CCTTTAATGG TGAAATGCTA CCCTCAAATT ATTGAAGGTC AAATTGTTTT CTTGCAGTTT       540
     TGTGGTGCTG CTGAACCGAC CCCTGAGACC CCTGAAGACT GGGTGATGAT CGGTGTGTGG       600
     AATTCAGAGA ATCAGCGAGT CTTAGTACAG CGTGATCAAA GATGCGATCA GAGCAGGCGC       660
     ATCCTTCAAC ATTCTCCGCT AGTGAAAGAG GCATGTTTGG AGAAACTGGA GGCTGGAAAG       720
     CTTTATCGGT ATCAATGTCA GAGAGAGGGA ATCACCGTGA CGATCGTGGG TGTGGAGGTT       780
     GTTGAGGGTG AGGAAGGGAA AATTGTTCAG GAAGCCTCAT AG                          822
//

If you have problems or comments...

PBIL Back to PBIL home page