(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE48

ACAM1_4.PE48         Location/Qualifiers
FT   CDS_pept        complement(53557..53802)
FT                   /locus_tag="AM1_C0048"
FT                   /gene_family="HOG000276232" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340503"
FT                   /db_xref="GeneID:5686270"
FT                   /translation="MRPLVQQDLNAVFAEYGTVKQVKMPTDRETGRKRGFAFVEMGNDA
FT                   EEAKAIDELEGAELMGRTLKVNKARPHENRGGGNRW"
FT                   /protein_id="YP_001521497.1"
     atgcgcccgc tggtccaaca agacctaaac gccgtttttg ctgaatatgg aactgtcaaa        60
     caggtcaaga tgcctactga tcgagaaaca ggacgcaagc gtggattcgc ctttgtcgaa       120
     atgggtaatg atgccgaaga agctaaagct atcgatgagc tagagggtgc tgaattgatg       180
     ggacgcactc tgaaagtgaa taaagccaga ccccatgaga acagaggtgg tggtaatcgc       240
     tggtag                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page