(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE49

ACAM1_4.PE49         Location/Qualifiers
FT   CDS_pept        complement(53775..53936)
FT                   /locus_tag="AM1_C0049"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340504"
FT                   /db_xref="GeneID:5686271"
FT                   /translation="MLVEARLGSKGECQKIDDFLSGFQYHNLEVMQEKGFRRKRYFLFK
FT                   CARWSNKT"
FT                   /protein_id="YP_001521498.1"
     gtgctggtcg aagccagatt gggttcaaaa ggcgaatgtc aaaaaatcga tgactttctt        60
     agcggattcc aatatcacaa tctggaggtt atgcaggaaa agggtttcag gcgaaagcgc       120
     tactttctgt tcaaatgcgc ccgctggtcc aacaagacct aa                          162
//

If you have problems or comments...

PBIL Back to PBIL home page