(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE50

ACAM1_4.PE50         Location/Qualifiers
FT   CDS_pept        54103..54990
FT                   /locus_tag="AM1_C0050"
FT                   /gene_family="HOG000244136" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methylated DNA-protein cysteine
FT                   methyltransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340505"
FT                   /db_xref="GeneID:5686272"
FT                   /translation="MGLRRLTPEDDPSDHYQMVAAAIAFIREHRFEQPALSTVAQHIGL
FT                   SEYHFQRLFTYWAGISPKRFLQYLTIEQAKATIAQTDSLLTLSEDLGLSGPSRLHDLFV
FT                   SIEAMSPGEYKNGGEGLEIYNGSHNTLFGTVVIATTKRGICSLQFQDKATLPVDDLLTN
FT                   TWPNATLTVDQEKTQGLCDRIFLPEMSQPTKPLTLLVKGTNFQVQVWRALLQIPLGGLT
FT                   TYQTIAEMIERPKAARAVGTAIGKNPIGYLIPCHRVIRGSGEIGGYSWGLDRKQAILGW
FT                   EAAQLNHSTIQEGS"
FT                   /protein_id="YP_001521499.1"
     ATGGGTCTAC GAAGACTTAC CCCGGAAGAC GACCCGTCAG ACCACTATCA GATGGTCGCA        60
     GCAGCAATCG CTTTTATTCG TGAGCATCGC TTTGAGCAGC CAGCCTTATC TACCGTTGCT       120
     CAGCACATCG GACTGAGTGA GTACCACTTT CAAAGGCTAT TTACCTATTG GGCAGGTATT       180
     AGCCCAAAGC GGTTTCTGCA ATATCTGACG ATTGAGCAAG CCAAAGCGAC TATTGCTCAA       240
     ACGGATAGTT TACTTACACT CAGCGAAGAT CTAGGTCTTT CAGGCCCTAG CCGTTTACAC       300
     GATCTGTTCG TTTCTATAGA AGCGATGTCA CCTGGCGAAT ATAAAAATGG TGGCGAAGGA       360
     CTAGAAATAT ACAACGGTTC GCACAACACC TTGTTTGGAA CCGTTGTGAT CGCCACAACA       420
     AAAAGAGGTA TCTGCTCACT TCAGTTTCAA GACAAGGCCA CGCTGCCTGT AGACGACTTG       480
     CTAACCAATA CTTGGCCGAA TGCCACGTTG ACTGTGGATC AGGAGAAAAC ACAGGGGTTG       540
     TGTGATCGCA TCTTTTTACC AGAGATGTCT CAGCCGACTA AGCCCTTGAC ACTGCTAGTT       600
     AAGGGAACAA ACTTTCAAGT CCAAGTCTGG CGAGCGTTGC TTCAAATTCC ACTAGGTGGT       660
     CTCACAACTT ACCAAACAAT CGCTGAGATG ATCGAGCGAC CTAAAGCTGC TAGGGCTGTC       720
     GGTACTGCCA TTGGCAAGAA TCCGATTGGC TATCTCATTC CTTGTCATCG TGTTATTCGA       780
     GGCTCAGGAG AGATCGGTGG CTACAGTTGG GGACTAGATC GCAAGCAAGC CATCTTAGGT       840
     TGGGAAGCTG CCCAACTCAA TCATTCAACC ATACAGGAAG GAAGCTAA                    888
//

If you have problems or comments...

PBIL Back to PBIL home page