(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE51

ACAM1_4.PE51         Location/Qualifiers
FT   CDS_pept        54990..55871
FT                   /locus_tag="AM1_C0051"
FT                   /gene_family="HOG000253120" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340506"
FT                   /db_xref="GeneID:5686273"
FT                   /translation="MRLSDVLELLLLSALWGGSFLFMRIAAPVLGPIWLIECRVLFAGL
FT                   ALLPLLLRSQAWSMICANLKSLFIVGSINSALPFLLLAFASLSLPAGYTSIVNATAPLF
FT                   GTLIATTWLHEKLTAARMVGLLSGFAGVVLLIGLQPMEITPVVIGSIVAGLLAAIMYAI
FT                   AAPFAKRRLSGIPPLVIATMTQLSAAVALLPLLPFTLPAAMPSTTIMLAVLALAFFSTS
FT                   LAYLLYFRLIQNIGASKALTVTYLVPIFAVLWGAVFLREAITVAMISGCCLILLGTAIA
FT                   NGLLFSASQRNL"
FT                   /protein_id="YP_001521500.1"
     ATGCGGTTAT CGGATGTCCT TGAACTTCTT CTGCTATCTG CGCTATGGGG CGGTTCGTTT        60
     TTGTTCATGC GCATAGCGGC ACCCGTACTA GGCCCAATCT GGCTAATTGA ATGCCGTGTG       120
     CTGTTCGCAG GACTAGCGCT ATTGCCTCTG CTACTTCGCT CTCAGGCATG GTCAATGATT       180
     TGTGCGAATC TCAAGTCCTT ATTCATCGTT GGCAGCATCA ATTCGGCACT GCCATTTCTT       240
     CTTCTAGCGT TTGCCTCGCT TTCTCTACCT GCAGGCTACA CCTCTATCGT TAATGCAACA       300
     GCACCTTTGT TCGGCACTTT GATAGCTACC ACCTGGCTCC ACGAGAAGCT AACGGCGGCT       360
     CGGATGGTAG GGCTACTGTC AGGCTTTGCT GGCGTTGTTC TACTGATTGG CTTACAGCCA       420
     ATGGAGATAA CTCCGGTGGT GATCGGCTCG ATTGTTGCTG GGCTACTGGC TGCAATAATG       480
     TATGCAATTG CCGCTCCATT TGCTAAACGC CGTCTGTCAG GAATACCACC TTTAGTGATT       540
     GCTACGATGA CTCAGCTTAG TGCTGCTGTA GCACTGCTGC CTTTGTTGCC TTTTACCTTA       600
     CCTGCAGCTA TGCCTTCAAC TACAATTATG CTAGCCGTTC TTGCATTAGC ATTTTTCTCT       660
     ACGTCGCTCG CTTATCTGTT GTACTTCCGT TTAATTCAAA ATATCGGAGC ATCTAAAGCA       720
     CTGACTGTAA CTTACCTAGT TCCAATTTTT GCCGTACTGT GGGGAGCAGT CTTCCTCCGT       780
     GAAGCGATTA CAGTTGCGAT GATCTCAGGA TGCTGCTTGA TTCTGTTGGG AACTGCCATC       840
     GCCAATGGTT TGCTATTTTC TGCCTCTCAG CGGAACCTGT AG                          882
//

If you have problems or comments...

PBIL Back to PBIL home page