(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE53

ACAM1_4.PE53         Location/Qualifiers
FT   CDS_pept        57058..57591
FT                   /locus_tag="AM1_C0053"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340508"
FT                   /db_xref="GeneID:5686275"
FT                   /translation="MKYTTNKTEASNTETLSSDELKAALAESERIGRQIYTGFNERKLD
FT                   LWDDVIASDVQLRSTVGDQPQYGLEALKNWTAEFHKAFQPRLDLVDEIYGVNRATIAVN
FT                   LIWQHVDEFFGLAPTGRKGTSIEYFILTHAEGKVTHYWVADHSLDLASYLTHERGLHYP
FT                   QNFEPEPIIRGIDF"
FT                   /protein_id="YP_001521502.1"
     ATGAAGTACA CCACCAACAA AACAGAAGCC TCAAATACGG AAACTCTGAG CAGTGATGAA        60
     CTCAAAGCAG CCCTTGCTGA ATCCGAGCGG ATTGGGCGAC AAATCTACAC AGGCTTCAAC       120
     GAGCGCAAAC TGGACCTATG GGATGATGTT ATAGCATCTG ATGTCCAACT CCGCAGTACA       180
     GTAGGCGATC AGCCCCAATA CGGTCTAGAA GCACTCAAAA ACTGGACTGC AGAATTCCAT       240
     AAAGCGTTTC AACCGCGTCT CGATTTGGTC GATGAAATCT ATGGTGTGAA TCGCGCTACG       300
     ATTGCCGTCA ATTTGATCTG GCAGCATGTG GATGAATTCT TTGGACTTGC TCCCACTGGT       360
     CGTAAAGGCA CTTCTATTGA GTACTTCATC TTGACTCACG CAGAGGGTAA AGTGACGCAC       420
     TACTGGGTCG CCGATCATAG CTTAGACCTC GCCTCTTATC TTACTCATGA GCGCGGTTTG       480
     CACTATCCCC AGAACTTTGA GCCAGAGCCG ATCATTCGCG GAATTGACTT TTAA             534
//

If you have problems or comments...

PBIL Back to PBIL home page