(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE54

ACAM1_4.PE54         Location/Qualifiers
FT   CDS_pept        57675..58619
FT                   /locus_tag="AM1_C0054"
FT                   /gene_family="HOG000294678" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase family
FT                   protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340509"
FT                   /db_xref="GeneID:5686276"
FT                   /translation="MQRIIMNSDQEGGLSFVETDSLQPLPHQSLIKVTAFSLNRGEINI
FT                   AQSPTSGGRSIGWDFVGVIENSAADGTGLKKGTRVVGWRPEMDAFAEYVIGEHQFIAPI
FT                   PDAVSDVQAATLPVAGLTALAAVDQGNRLVGNSALVTGVTGGVGYFALQLAKLSGARTV
FT                   AQVRRSEQATFASNIGADAVVVTEDGSGLEGEGPYHLVVDGVGGQLFSSLLSVTAKGGT
FT                   LVSYGSSESHESTVNLYPALFGNGGQRRIYGLTLYSEIEKEPSSAALTRLLNLVERDLL
FT                   KLPETITSDWSETPHLAEDLLARKFTGKAVLTL"
FT                   /protein_id="YP_001521503.1"
     ATGCAACGCA TCATCATGAA CTCAGATCAA GAAGGCGGTC TTTCTTTTGT CGAAACCGAT        60
     TCCCTCCAAC CTTTACCGCA CCAAAGTCTG ATTAAGGTCA CGGCCTTTTC TCTCAACCGT       120
     GGTGAGATCA ATATTGCTCA ATCTCCAACA AGCGGGGGTA GAAGCATTGG CTGGGATTTC       180
     GTCGGCGTTA TTGAGAACTC AGCGGCTGAT GGCACCGGGC TAAAGAAGGG CACACGGGTC       240
     GTCGGCTGGC GACCGGAAAT GGATGCATTT GCTGAATATG TAATTGGAGA ACACCAGTTC       300
     ATTGCTCCTA TTCCCGATGC TGTTTCCGAC GTCCAGGCTG CAACTTTGCC AGTTGCGGGC       360
     TTAACTGCCC TCGCAGCAGT GGATCAGGGA AATCGCCTAG TGGGCAATTC AGCTCTCGTT       420
     ACTGGAGTCA CAGGTGGTGT TGGCTACTTT GCTCTACAAC TCGCTAAGCT AAGTGGTGCA       480
     AGAACGGTAG CTCAGGTTCG TCGATCCGAG CAAGCAACGT TCGCTAGCAA TATTGGTGCA       540
     GATGCAGTGG TCGTAACAGA AGATGGGTCA GGGCTAGAGG GAGAAGGACC TTATCATCTG       600
     GTTGTGGACG GCGTTGGCGG TCAACTATTT AGCTCATTGC TGAGCGTCAC AGCAAAGGGA       660
     GGCACTCTAG TATCCTATGG TTCCTCTGAG AGTCATGAAT CGACTGTTAA TCTCTATCCT       720
     GCGCTTTTTG GTAACGGGGG ACAACGTCGA ATCTATGGTC TAACGCTCTA CAGCGAAATT       780
     GAAAAGGAAC CCTCGTCTGC AGCTTTGACG CGGCTTCTGA ATCTGGTTGA GCGAGATCTA       840
     TTGAAATTGC CTGAAACTAT AACTTCAGAT TGGTCAGAAA CCCCTCATCT TGCCGAAGAC       900
     CTATTGGCGC GTAAGTTCAC TGGCAAAGCT GTATTAACCC TCTGA                       945
//

If you have problems or comments...

PBIL Back to PBIL home page